bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7920_orf2 Length=57 Score E Sequences producing significant alignments: (Bits) Value ath:AT2G42120 POLD2; POLD2 (DNA POLYMERASE DELTA SMALL SUBUNIT... 74.3 1e-13 dre:796456 pold2, MGC55633, MGC77043, si:dz150f13.3, zgc:55633... 34.3 0.089 pfa:PFC0340w DNA polymerase epsilon subunit B, putative; K0232... 33.5 0.19 > ath:AT2G42120 POLD2; POLD2 (DNA POLYMERASE DELTA SMALL SUBUNIT); DNA binding / DNA-directed DNA polymerase; K02328 DNA polymerase delta subunit 2 Length=441 Score = 74.3 bits (181), Expect = 1e-13, Method: Composition-based stats. Identities = 37/47 (78%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Query 11 ERVQCAYASL-DEAFEIGKEAYQGQQYSQIYFARLHLMRTLLYSLVP 56 ER Q Y SL DE FEI KE Y+GQQYSQIYFARLHLMRTLLYSL P Sbjct 10 ERKQSDYNSLQDERFEIQKEMYRGQQYSQIYFARLHLMRTLLYSLAP 56 > dre:796456 pold2, MGC55633, MGC77043, si:dz150f13.3, zgc:55633, zgc:77043; polymerase (DNA directed), delta 2, regulatory subunit (EC:2.7.7.7); K02328 DNA polymerase delta subunit 2 Length=467 Score = 34.3 bits (77), Expect = 0.089, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query 11 ERVQCAYASLDEAFEIGKEAYQGQQYSQIYFARLHLMRTLLYSLVPH 57 ER + AY+ E F IG+ ++ +QY+ IY RL MR +L H Sbjct 24 ERAEPAYSGCSERFRIGERSF-SRQYAHIYATRLMQMRQILTERATH 69 > pfa:PFC0340w DNA polymerase epsilon subunit B, putative; K02328 DNA polymerase delta subunit 2 Length=498 Score = 33.5 bits (75), Expect = 0.19, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query 1 NEGSVPAMGMERVQCAYASLDEAFEIGKEAYQGQQYSQIYFARLHLMRTLL 51 NEG +++ Y +L E F I Y QQ+S IY R+ +M+TLL Sbjct 23 NEGEHQNKKIKKKHFEYVNLSERFIITCPTYT-QQFSHIYSLRIKIMKTLL 72 Lambda K H 0.322 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2082685716 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40