bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_7511_orf1 Length=81 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_024950 protein kinase 6, putative (EC:1.6.3.1 2.7.1... 62.8 2e-10 cel:C15F1.3 tra-2; TRAnsformer : XX animals transformed into m... 27.7 8.4 dre:560557 SH2 domain containing 4B-like 27.7 9.0 > tgo:TGME49_024950 protein kinase 6, putative (EC:1.6.3.1 2.7.11.17); K13412 calcium-dependent protein kinase [EC:2.7.11.1] Length=681 Score = 62.8 bits (151), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 8/56 (14%) Query 33 ADHHCHGPE-----EKPHFFSLCTKCATDGKDKPL---REPAKGFITRSESYVNAS 80 AD+ C G + KPHFFSLCTKCA +GKDK REP +G I RSES++NAS Sbjct 92 ADYGCRGGDCCDTSTKPHFFSLCTKCANEGKDKSQHDRREPVRGLIIRSESFMNAS 147 > cel:C15F1.3 tra-2; TRAnsformer : XX animals transformed into males family member (tra-2) Length=1475 Score = 27.7 bits (60), Expect = 8.4, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query 26 PCRPNCAAD-HHCHGPEEKPHFFSLCT 51 P + CAA H C P + H+F++CT Sbjct 238 PRQKTCAASIHSCDTPLDSEHYFNICT 264 > dre:560557 SH2 domain containing 4B-like Length=423 Score = 27.7 bits (60), Expect = 9.0, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query 8 NMQKDKRLDTAEGRPLESPCRP-NCAADH 35 N K++ + T+ G L+ PCRP + AADH Sbjct 390 NFHKEEVITTSGGELLQDPCRPRSSAADH 418 Lambda K H 0.314 0.131 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2053886800 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40