bitscore colors: <40, 40-50 , 50-80, 80-200, >200

BLASTP 2.2.24+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
Database: egene_temp_file_orthology_annotation_similarity_blast_database_866
164,496 sequences; 82,071,388 total letters
Query= Eten_6583_orf3
Length=60
Score E
Sequences producing significant alignments: (Bits) Value
tgo:TGME49_032590 gamma-glutamylcysteine synthetase, putative ... 72.8 3e-13
pfa:PFI0925w gamma-glutamylcysteine synthetase (EC:6.3.2.2); K... 63.5 2e-10
xla:100137615 gclc; glutamate-cysteine ligase, catalytic subun... 58.9 4e-09
xla:100049719 glutamate-cysteine ligase, catalytic subunit (EC... 58.5 5e-09
cel:F37B12.2 gcs-1; gamma GlutamylCysteine Synthetase family m... 58.2 6e-09
mmu:14629 Gclc, D9Wsu168e, GLCL-H, Ggcs-hs, Glclc; glutamate-c... 56.6 2e-08
hsa:2729 GCLC, GCL, GCS, GLCL, GLCLC; glutamate-cysteine ligas... 55.8 3e-08
dre:326857 gclc, cb1049, fe36e11, wu:fe36e11; glutamate-cystei... 55.5 4e-08
bbo:BBOV_I002580 19.m02298; glutamate-cysteine ligase catalyti... 48.9 4e-06
sce:YJL101C GSH1; Gamma glutamylcysteine synthetase catalyzes ... 47.4 1e-05
tpv:TP03_0084 gamma-glutamylcysteine synthetase (EC:6.3.2.2); ... 41.6 7e-04
> tgo:TGME49_032590 gamma-glutamylcysteine synthetase, putative
(EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic
subunit [EC:6.3.2.2]
Length=1062
Score = 72.8 bits (177), Expect = 3e-13, Method: Composition-based stats.
Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60
YDQL VLA L + +TA TPFLRG VAATDTRW TI+ +VD R +E + + KSRY + SL
Sbjct 399 YDQLGVLAPLWLSLTAATPFLRGLVAATDTRWATIAGAVDCRTSKESRALPKSRYGAFSL 458
> pfa:PFI0925w gamma-glutamylcysteine synthetase (EC:6.3.2.2);
K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Length=1063
Score = 63.5 bits (153), Expect = 2e-10, Method: Composition-based stats.
Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60
YDQL V+A L + +TA TP+L G + TDTRW IS SVD R EE I K RYS SL
Sbjct 546 YDQLAVIAPLFLALTACTPYLGGFLTETDTRWRVISNSVDCRTEEELSYICKPRYSGISL 605
> xla:100137615 gclc; glutamate-cysteine ligase, catalytic subunit
(EC:6.3.2.2); K11204 glutamate--cysteine ligase catalytic
subunit [EC:6.3.2.2]
Length=637
Score = 58.9 bits (141), Expect = 4e-09, Method: Composition-based stats.
Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 9/66 (13%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51
YDQL + +MM ++A PF RG V+ D RW IS SVD R EE K +I+
Sbjct 267 YDQLATICPIMMALSAAAPFYRGYVSDIDCRWGVISASVDDRTKEERGLEPLKNSKYRIS 326
Query 52 KSRYSS 57
KSRY S
Sbjct 327 KSRYDS 332
> xla:100049719 glutamate-cysteine ligase, catalytic subunit (EC:6.3.2.2)
Length=637
Score = 58.5 bits (140), Expect = 5e-09, Method: Composition-based stats.
Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 9/66 (13%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51
YDQL + +MM ++A PF RG V+ D RW IS SVD R EE K +I+
Sbjct 267 YDQLATICPIMMALSAAAPFYRGYVSDIDCRWGVISASVDDRTKEERGLEPLKNNKYRIS 326
Query 52 KSRYSS 57
KSRY S
Sbjct 327 KSRYDS 332
> cel:F37B12.2 gcs-1; gamma GlutamylCysteine Synthetase family
member (gcs-1); K11204 glutamate--cysteine ligase catalytic
subunit [EC:6.3.2.2]
Length=654
Score = 58.2 bits (139), Expect = 6e-09, Method: Composition-based stats.
Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 9/66 (13%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51
YDQL + +++ ++A TP RG ++ D+RWD IS SVD R PEE K I
Sbjct 271 YDQLTPITPILLALSAATPIFRGKLSNVDSRWDIISASVDDRTPEERGLEPLKNSKWVID 330
Query 52 KSRYSS 57
KSRY S
Sbjct 331 KSRYDS 336
> mmu:14629 Gclc, D9Wsu168e, GLCL-H, Ggcs-hs, Glclc; glutamate-cysteine
ligase, catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine
ligase catalytic subunit [EC:6.3.2.2]
Length=637
Score = 56.6 bits (135), Expect = 2e-08, Method: Composition-based stats.
Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 9/66 (13%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQ---------KIT 51
YDQL + ++M ++A +PF RG V+ D RW IS SVD R EE+ +I+
Sbjct 266 YDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNRFRIS 325
Query 52 KSRYSS 57
KSRY S
Sbjct 326 KSRYDS 331
> hsa:2729 GCLC, GCL, GCS, GLCL, GLCLC; glutamate-cysteine ligase,
catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine
ligase catalytic subunit [EC:6.3.2.2]
Length=599
Score = 55.8 bits (133), Expect = 3e-08, Method: Composition-based stats.
Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 9/66 (13%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEK---------QKIT 51
YDQL + ++M ++A +PF RG V+ D RW IS SVD R EE+ +I+
Sbjct 228 YDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISASVDDRTREERGLEPLKNNNYRIS 287
Query 52 KSRYSS 57
KSRY S
Sbjct 288 KSRYDS 293
> dre:326857 gclc, cb1049, fe36e11, wu:fe36e11; glutamate-cysteine
ligase, catalytic subunit (EC:6.3.2.2); K11204 glutamate--cysteine
ligase catalytic subunit [EC:6.3.2.2]
Length=631
Score = 55.5 bits (132), Expect = 4e-08, Method: Composition-based stats.
Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 9/66 (13%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEE---------KQKIT 51
YDQL ++M ++A +PF RG V+ D RW IS SVD R EE K +I
Sbjct 267 YDQLATFCPIVMALSAASPFYRGFVSDIDCRWGVISASVDDRTREERGLESLKNNKFRIH 326
Query 52 KSRYSS 57
KSRY S
Sbjct 327 KSRYDS 332
> bbo:BBOV_I002580 19.m02298; glutamate-cysteine ligase catalytic
subunit (EC:6.3.2.2); K11204 glutamate--cysteine ligase
catalytic subunit [EC:6.3.2.2]
Length=685
Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats.
Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 0/60 (0%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60
YDQL VLA L + +TA T +G +++ TRW +S SVD R+ EE +++ SR+S+ SL
Sbjct 359 YDQLTVLAPLFLALTAATAAHKGLMSSHTTRWRVLSQSVDDRRDEEHERVPFSRFSTVSL 418
> sce:YJL101C GSH1; Gamma glutamylcysteine synthetase catalyzes
the first step in glutathione (GSH) biosynthesis; expression
induced by oxidants, cadmium, and mercury (EC:6.3.2.2); K11204
glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Length=678
Score = 47.4 bits (111), Expect = 1e-05, Method: Composition-based stats.
Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 0/47 (0%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEK 47
YD L+ A +M+ +A P +G +A D RW+ IS +VD R P+E+
Sbjct 283 YDALVNFAPIMLAFSAAAPAFKGWLADQDVRWNVISGAVDDRTPKER 329
> tpv:TP03_0084 gamma-glutamylcysteine synthetase (EC:6.3.2.2);
K11204 glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Length=867
Score = 41.6 bits (96), Expect = 7e-04, Method: Composition-based stats.
Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 0/60 (0%)
Query 1 YDQLIVLAALMMLITAGTPFLRGCVAATDTRWDTISMSVDSRKPEEKQKITKSRYSSNSL 60
+DQLI L + + +++ T RG ++ D RW + ++D +++ I K RY++ SL
Sbjct 493 HDQLIPLTPIFLSLSSATVAFRGELSNIDNRWPVLVQAMDDLDDQDRSYILKGRYNTTSL 552
Lambda K H
0.318 0.128 0.362
Gapped
Lambda K H
0.267 0.0410 0.140
Effective search space used: 2069361540
Database: egene_temp_file_orthology_annotation_similarity_blast_database_866
Posted date: Sep 17, 2011 2:57 PM
Number of letters in database: 82,071,388
Number of sequences in database: 164,496
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40