bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_6329_orf1 Length=60 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_090950 clathrin heavy chain, putative ; K04646 clat... 99.8 2e-21 ath:AT3G11130 clathrin heavy chain, putative; K04646 clathrin ... 80.1 2e-15 ath:AT3G08530 clathrin heavy chain, putative; K04646 clathrin ... 78.2 5e-15 dre:100330183 cltc; clathrin, heavy chain (Hc) 72.4 4e-13 xla:444287 cltc, MGC80936; clathrin, heavy chain (Hc); K04646 ... 68.9 3e-12 pfa:PFL0930w clathrin heavy chain, putative; K04646 clathrin h... 68.6 5e-12 dre:503600 cltcb, im:7145213, zgc:113234; clathrin, heavy poly... 68.2 6e-12 hsa:1213 CLTC, CHC, CHC17, CLH-17, CLTCL2, Hc, KIAA0034; clath... 68.2 7e-12 mmu:67300 Cltc, 3110065L21Rik, CHC, MGC92975, R74732; clathrin... 68.2 7e-12 hsa:8218 CLTCL1, CHC22, CLH22, CLTCL, CLTD, FLJ36032; clathrin... 67.8 7e-12 dre:323579 cltca, cb1033, cltc, wu:fc03e11, wu:fc49a11, wu:fd0... 67.8 9e-12 cel:T20G5.1 chc-1; Clathrin Heavy Chain family member (chc-1);... 65.5 4e-11 cpv:cgd8_1270 clathrin heavy chain ; K04646 clathrin heavy chain 48.1 7e-06 sce:YGL206C CHC1, SWA5; Chc1p; K04646 clathrin heavy chain 42.7 3e-04 bbo:BBOV_IV001820 21.m02773; clathrin heavy chain; K04646 clat... 33.5 0.18 eco:b4395 ytjC, ECK4387, gpmB, JW4358; predicted phosphoglycer... 30.4 1.3 > tgo:TGME49_090950 clathrin heavy chain, putative ; K04646 clathrin heavy chain Length=1731 Score = 99.8 bits (247), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 50/58 (86%), Positives = 52/58 (89%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELWAYVLR EN +RR IDQVVSSALPESSSADEVSAAVNAFI+AQLP EL ELLEKI Sbjct 986 ELWAYVLREENPHRRQAIDQVVSSALPESSSADEVSAAVNAFINAQLPHELIELLEKI 1043 > ath:AT3G11130 clathrin heavy chain, putative; K04646 clathrin heavy chain Length=1705 Score = 80.1 bits (196), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 39/59 (66%), Positives = 46/59 (77%), Gaps = 0/59 (0%) Query 2 AELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 +LW VL EN YRR +IDQVVS+ALPES S ++VSAAV AF++A LP EL ELLEKI Sbjct 967 GDLWEKVLTEENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKI 1025 > ath:AT3G08530 clathrin heavy chain, putative; K04646 clathrin heavy chain Length=1703 Score = 78.2 bits (191), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 38/59 (64%), Positives = 45/59 (76%), Gaps = 0/59 (0%) Query 2 AELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 +LW VL N YRR +IDQVVS+ALPES S ++VSAAV AF++A LP EL ELLEKI Sbjct 967 GDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKI 1025 > dre:100330183 cltc; clathrin, heavy chain (Hc) Length=951 Score = 72.4 bits (176), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 +LWA VL N YRR +IDQVV +ALPE+ +EVS V AF++A LP EL ELLEKI Sbjct 460 DLWARVLEETNPYRRPLIDQVVQTALPETQDPEEVSVTVKAFMTADLPNELIELLEKI 517 > xla:444287 cltc, MGC80936; clathrin, heavy chain (Hc); K04646 clathrin heavy chain Length=1675 Score = 68.9 bits (167), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELWA VL N YRR +IDQVV +AL E+ +EVS V AF++A LP EL ELLEKI Sbjct 954 ELWASVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKI 1011 > pfa:PFL0930w clathrin heavy chain, putative; K04646 clathrin heavy chain Length=1997 Score = 68.6 bits (166), Expect = 5e-12, Method: Composition-based stats. Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELW VL N YR++VIDQV+ S L ES++ADE++ V AFI +L EL ELLEKI Sbjct 1161 ELWKVVLDETNKYRKNVIDQVIGSTLIESNNADEITVTVKAFIEKKLSSELIELLEKI 1218 > dre:503600 cltcb, im:7145213, zgc:113234; clathrin, heavy polypeptide b (Hc); K04646 clathrin heavy chain Length=1677 Score = 68.2 bits (165), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELWA VL N YRR +IDQVV +AL E+ +EVS V AF++A LP EL ELLEKI Sbjct 954 ELWASVLLEVNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKI 1011 > hsa:1213 CLTC, CHC, CHC17, CLH-17, CLTCL2, Hc, KIAA0034; clathrin, heavy chain (Hc); K04646 clathrin heavy chain Length=1675 Score = 68.2 bits (165), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELW VL N YRR +IDQVV +AL E+ +EVS V AF++A LP EL ELLEKI Sbjct 954 ELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKI 1011 > mmu:67300 Cltc, 3110065L21Rik, CHC, MGC92975, R74732; clathrin, heavy polypeptide (Hc); K04646 clathrin heavy chain Length=1675 Score = 68.2 bits (165), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELW VL N YRR +IDQVV +AL E+ +EVS V AF++A LP EL ELLEKI Sbjct 954 ELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKI 1011 > hsa:8218 CLTCL1, CHC22, CLH22, CLTCL, CLTD, FLJ36032; clathrin, heavy chain-like 1; K04646 clathrin heavy chain Length=1583 Score = 67.8 bits (164), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELWA+VL N RR +IDQVV +AL E+ +E+S V AF++A LP EL ELLEKI Sbjct 954 ELWAHVLEETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKI 1011 > dre:323579 cltca, cb1033, cltc, wu:fc03e11, wu:fc49a11, wu:fd07f02; clathrin, heavy polypeptide a (Hc); K04646 clathrin heavy chain Length=1680 Score = 67.8 bits (164), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 0/58 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ELWA VL N +RR +IDQVV +AL E+ +EVS V AF++A LP EL ELLEKI Sbjct 954 ELWASVLLETNPFRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKI 1011 > cel:T20G5.1 chc-1; Clathrin Heavy Chain family member (chc-1); K04646 clathrin heavy chain Length=1681 Score = 65.5 bits (158), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%) Query 4 LWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 LW VL EN +RR +IDQVV +AL E+ +++S V AF++A LP EL ELLEKI Sbjct 957 LWEQVLNEENVHRRQLIDQVVQTALSETQDPEDISVTVKAFMAADLPNELIELLEKI 1013 > cpv:cgd8_1270 clathrin heavy chain ; K04646 clathrin heavy chain Length=2007 Score = 48.1 bits (113), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Query 16 RRSVIDQVVSSALPE-SSSADEVSAAVNAFISAQLPQELTELLEKI 60 R+++IDQV SS LPE + ++E+S + AFI+A++P L E+LEKI Sbjct 1158 RQAIIDQVTSSILPEFYNKSEEISCVIRAFINAEVPNSLLEVLEKI 1203 > sce:YGL206C CHC1, SWA5; Chc1p; K04646 clathrin heavy chain Length=1653 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 0/44 (0%) Query 3 ELWAYVLRPENSYRRSVIDQVVSSALPESSSADEVSAAVNAFIS 46 +LW VL EN +RR +ID V+S +PE + + VS V AF++ Sbjct 960 DLWNKVLNQENIHRRQLIDSVISVGIPELTDPEPVSLTVQAFMT 1003 > bbo:BBOV_IV001820 21.m02773; clathrin heavy chain; K04646 clathrin heavy chain Length=1676 Score = 33.5 bits (75), Expect = 0.18, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Query 12 ENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISAQLPQELTELLEKI 60 ++ R+ V +++V A P+SS+A E+S A+ A + A + +E+ LLE++ Sbjct 1008 DDDNRKHVCEELVILA-PDSSNASEISCALKALLDAGMNEEVIALLEQL 1055 > eco:b4395 ytjC, ECK4387, gpmB, JW4358; predicted phosphoglyceromutase 2, co-factor independent; K01834 phosphoglycerate mutase [EC:5.4.2.1] Length=215 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query 12 ENSYRRSVIDQVVSSALPESSSADEVSAAVNAFISA--QLPQ 51 E ++RR +++ V +PE S E+S VNA + + LPQ Sbjct 100 EENWRRQLVNGTVDGRIPEGESMQELSDRVNAALESCRDLPQ 141 Lambda K H 0.311 0.124 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2069361540 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40