bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_5605_orf1 Length=106 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 i... 65.1 5e-11 tgo:TGME49_031920 sepiapterin reductase, putative (EC:1.1.1.15... 29.6 2.5 tgo:TGME49_033740 hypothetical protein 28.5 5.1 tpv:TP01_1173 hypothetical protein; K11324 DNA methyltransfera... 28.1 7.8 > tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 insulysin [EC:3.4.24.56] Length=953 Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%) Query 1 DFKKSADEIFSHANCFSKRDLEVKYLDNDFSRKHLLRTFTKLSDPSRRMVVKLIADLEPA 60 +F +S +I +H +CF+KRDLE+ YL+ +F+RK L RT+TKL +P+RR+V ++ + P Sbjct 885 EFGRSWGQIANHGHCFNKRDLELIYLNTEFNRKQLSRTYTKLLEPTRRLVGFVLNHVTPC 944 > tgo:TGME49_031920 sepiapterin reductase, putative (EC:1.1.1.153); K00072 sepiapterin reductase [EC:1.1.1.153] Length=303 Score = 29.6 bits (65), Expect = 2.5, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Query 34 HLLRTFTKLSDPSRRMVVKLIADLEPAKE-VTLIGEAKG 71 + +TF+K++D S + + I++L P+K V LIG +KG Sbjct 4 YCAKTFSKMADTSVKRSTREISNLFPSKALVLLIGASKG 42 > tgo:TGME49_033740 hypothetical protein Length=468 Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 60 AKEVTLIGEAKGQDAALLRRGDTAEEV 86 AKE+ ++GE +G+ A LL R D E V Sbjct 320 AKEICIVGEVRGEPAVLLVRLDAPEAV 346 > tpv:TP01_1173 hypothetical protein; K11324 DNA methyltransferase 1-associated protein 1 Length=611 Score = 28.1 bits (61), Expect = 7.8, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 0/68 (0%) Query 27 DNDFSRKHLLRTFTKLSDPSRRMVVKLIADLEPAKEVTLIGEAKGQDAALLRRGDTAEEV 86 D+D R+ +L +++ R M +L++D++ A+ + E K + L+R E Sbjct 231 DHDRDRRQMLERSYRITPEQREMEAQLLSDIKAAESLLKSEEKKRSEMKRLKRKFNVNES 290 Query 87 VKAPTKLL 94 PT L Sbjct 291 EVIPTPRL 298 Lambda K H 0.317 0.132 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2012750684 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40