bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_5240_orf1 Length=109 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_095680 periodic tryptophan protein PWP2, putative ;... 79.3 3e-15 pfa:PF08_0130 WD-repeat protein, putative; K14558 periodic try... 54.7 8e-08 bbo:BBOV_II001010 18.m06073; periodic tryptophan protein 2-lik... 52.4 4e-07 tpv:TP04_0485 hypothetical protein; K14558 periodic tryptophan... 46.6 2e-05 sce:YCR057C PWP2, UTP1, YCR055C, YCR058C; Conserved 90S pre-ri... 42.4 4e-04 cpv:cgd2_2910 hypothetical protein ; K14558 periodic tryptopha... 40.8 0.001 xla:734637 hypothetical protein MGC115367; K14558 periodic try... 37.0 0.015 hsa:57602 USP36, DUB1; ubiquitin specific peptidase 36 (EC:3.4... 33.1 0.24 cel:F55F8.3 hypothetical protein; K14558 periodic tryptophan p... 32.3 0.39 dre:266990 pwp2h, cb471, zgc:56063; PWP2 periodic tryptophan p... 31.6 0.60 tgo:TGME49_077930 hypothetical protein 31.6 0.73 mmu:258387 Olfr720, MOR274-2; olfactory receptor 720; K04257 o... 30.4 1.5 dre:569963 syntaphilin-like 29.3 3.4 mmu:18330 Olfr31, MGC123774, MGC123790, MOR274-1, MTPCR53; olf... 28.5 5.0 hsa:11128 POLR3A, RPC1, RPC155, hRPC155; polymerase (RNA) III ... 28.5 5.1 hsa:26696 OR2T1, OR1-25; olfactory receptor, family 2, subfami... 28.5 5.1 mmu:211978 Zfyve26, 4930465A13, 9330197E15Rik, A630028O16Rik, ... 28.1 7.0 > tgo:TGME49_095680 periodic tryptophan protein PWP2, putative ; K14558 periodic tryptophan protein 2 Length=1266 Score = 79.3 bits (194), Expect = 3e-15, Method: Composition-based stats. Identities = 40/82 (48%), Positives = 53/82 (64%), Gaps = 2/82 (2%) Query 6 FFIYGIDLFGGILGNYGVTE--TGMSLPFLTKNVTTSNIAKALHNEEYAKAFLLALVANN 63 +I+ +D GI +G + P LT NVTT +I++AL EYAKAF+L+LV N+ Sbjct 1044 LYIFSLDSKSGIYAAFGTSSRLPCAPPPMLTANVTTGSISRALERREYAKAFILSLVLND 1103 Query 64 RPTLLCVYERIPAASVPLVCSS 85 PTLL +YE IP +SV LVCSS Sbjct 1104 LPTLLSIYEAIPPSSVALVCSS 1125 > pfa:PF08_0130 WD-repeat protein, putative; K14558 periodic tryptophan protein 2 Length=1121 Score = 54.7 bits (130), Expect = 8e-08, Method: Composition-based stats. Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Query 22 GVTETGMSLP-FLTKNVTTSNIAKALHNEEYAKAFLLALVANNRPTLLCVYERIPAASVP 80 G+ + +P FLT+NV +N+ +L +EY KAF+L+L NN +L VYE IP +P Sbjct 936 GLISPNIYVPKFLTQNVNLNNLKNSLKKKEYMKAFILSLALNNYENILEVYENIPYNIIP 995 Query 81 LVCSSLSAALL 91 L L+ L Sbjct 996 LCVKVLTKPFL 1006 > bbo:BBOV_II001010 18.m06073; periodic tryptophan protein 2-like protein; K14558 periodic tryptophan protein 2 Length=988 Score = 52.4 bits (124), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 32/89 (35%), Positives = 51/89 (57%), Gaps = 11/89 (12%) Query 6 FFIYGIDLF-------GGILGNYGVTETGMSLPFLTKNVTTSNIAKALHNEEYAKAFLLA 58 ++Y +D F G + + G+ + + LTKNVT N+ AL + ++ KAF+LA Sbjct 799 LYVYSMDAFIKTPNYLGEVFKSVGLFQPQL----LTKNVTVGNVLGALESGDHIKAFILA 854 Query 59 LVANNRPTLLCVYERIPAASVPLVCSSLS 87 L N+ TLL YE +PA+SV V +S++ Sbjct 855 LALNDFNTLLRCYESVPASSVSHVVASIA 883 > tpv:TP04_0485 hypothetical protein; K14558 periodic tryptophan protein 2 Length=968 Score = 46.6 bits (109), Expect = 2e-05, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 0/59 (0%) Query 33 LTKNVTTSNIAKALHNEEYAKAFLLALVANNRPTLLCVYERIPAASVPLVCSSLSAALL 91 +TK+VT S+I L ++ AF+LAL NN +L YE +P + V SSL + L+ Sbjct 818 ITKSVTKSSILSHLEKNDFVGAFILALAMNNFKIMLKAYEAVPTGKIASVVSSLDSTLV 876 > sce:YCR057C PWP2, UTP1, YCR055C, YCR058C; Conserved 90S pre-ribosomal component essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis; K14558 periodic tryptophan protein 2 Length=923 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Query 21 YGVTETGMSLPF-LTKNVTTSNIAKALHNEEYAKAFLLALVANNRPTLLCVYERIPAASV 79 Y +T + PF L +VT + +AL +++ A ++A N + VYE IP + Sbjct 704 YSTNDTILFDPFDLDVDVTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEI 763 Query 80 PLVCSSLSAALLPSL 94 PLV S++ A LP + Sbjct 764 PLVASNIPAIYLPRI 778 > cpv:cgd2_2910 hypothetical protein ; K14558 periodic tryptophan protein 2 Length=1003 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 9/108 (8%) Query 7 FIYGIDLFGGILGNYGVTETGMSL------PFLTKNVTTSNIAKALHNEEYAKAFLLALV 60 F++ ID G +Y + T +++ +TK V SNI L ++ + +LAL Sbjct 790 FLFCIDTLGN---SYSGSSTHLNMLDTFKKQIMTKEVNVSNIDHFLKEGDFLRGLILALA 846 Query 61 ANNRPTLLCVYERIPAASVPLVCSSLSAALLPSLSSPPQCVTVKKAQQ 108 NN L Y +IP S+ + ++ + LP++ + + VT +Q Sbjct 847 MNNFNILAKAYVQIPITSIDYIVQNIVSFFLPNILNFLRIVTSPNNKQ 894 > xla:734637 hypothetical protein MGC115367; K14558 periodic tryptophan protein 2 Length=895 Score = 37.0 bits (84), Expect = 0.015, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query 31 PF-LTKNVTTSNIAKALHNEEYAKAFLLALVANNRPTLLCVYERIPAASVPLVCSSL 86 PF L + VT + +A+ E+ +A ++A+ N L E +P A + ++CSSL Sbjct 730 PFDLDEEVTAGGVRRAVRGGEWTRAIVMAMRLNEESLLRETLESVPCADIAVLCSSL 786 > hsa:57602 USP36, DUB1; ubiquitin specific peptidase 36 (EC:3.4.19.12); K11855 ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15] Length=1123 Score = 33.1 bits (74), Expect = 0.24, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 13/56 (23%) Query 65 PTLLCVYERIPAASVPLVCSSLSAAL-------------LPSLSSPPQCVTVKKAQ 107 PTLL + P S P CSS+S AL LP S PPQ + K+ + Sbjct 759 PTLLSSTPKPPGTSEPRSCSSISTALPQVNEDLVSLPHQLPEASEPPQSPSEKRKK 814 > cel:F55F8.3 hypothetical protein; K14558 periodic tryptophan protein 2 Length=910 Score = 32.3 bits (72), Expect = 0.39, Method: Composition-based stats. Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Query 21 YGVTETGMSLPFLTKNVTTSNIAK-ALHNEEYAKAFLLALVANNRPTLLCVYERIPAASV 79 Y + M PF + T + + K A+ N +Y+ A + +L NN + E + + Sbjct 716 YSLDTISMFDPFQLDSQTNAEVIKRAVWNNDYSTAIMASLRLNNAQYITECLESTSISQI 775 Query 80 PLVCSSL 86 PLV SSL Sbjct 776 PLVASSL 782 > dre:266990 pwp2h, cb471, zgc:56063; PWP2 periodic tryptophan protein homolog (yeast); K14558 periodic tryptophan protein 2 Length=937 Score = 31.6 bits (70), Expect = 0.60, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 0/54 (0%) Query 33 LTKNVTTSNIAKALHNEEYAKAFLLALVANNRPTLLCVYERIPAASVPLVCSSL 86 L +VT ++I + + +E+A A LL N + V E IP + +VCSSL Sbjct 753 LDIDVTPTSIRQQITKKEWASAILLFFRLNEILLIREVLEAIPFDQITVVCSSL 806 > tgo:TGME49_077930 hypothetical protein Length=1573 Score = 31.6 bits (70), Expect = 0.73, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query 64 RPTLLCVYERIPAASVPLVCSSLSAALLPSLSSP 97 RPT L R P AS PL C +++++LL SL+SP Sbjct 433 RPTDLDALIRSPPAS-PLCCIAVASSLLRSLASP 465 > mmu:258387 Olfr720, MOR274-2; olfactory receptor 720; K04257 olfactory receptor Length=316 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query 1 RQFCWFFIYGIDLFGGILGNYGVTETGMSLPF 32 R+ CWF I FGG L ++ +T MSLPF Sbjct 137 RRVCWF-ILASSWFGGALDSFLLTPITMSLPF 167 > dre:569963 syntaphilin-like Length=626 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 15/61 (24%) Query 52 AKAFLL---ALVANNRPTLLCVYERIPAAS------------VPLVCSSLSAALLPSLSS 96 +KA LL A ++ +LL Y R+P +S VPL CSS+ A SLS Sbjct 254 SKADLLLEAAFLSQETASLLNAYSRLPHSSTYEGLCSSEPRVVPLRCSSIGAGASVSLSH 313 Query 97 P 97 P Sbjct 314 P 314 > mmu:18330 Olfr31, MGC123774, MGC123790, MOR274-1, MTPCR53; olfactory receptor 31; K04257 olfactory receptor Length=317 Score = 28.5 bits (62), Expect = 5.0, Method: Compositional matrix adjust. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query 1 RQFCWFFIYGIDLFGGILGNYGVTETGMSLPF 32 R+ CW I G FGG L + +T MS PF Sbjct 137 RRICWIIIAG-SWFGGSLDGFLLTPITMSFPF 167 > hsa:11128 POLR3A, RPC1, RPC155, hRPC155; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (EC:2.7.7.6); K03018 DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6] Length=1390 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Query 47 HNEEYAKAFLLALVANNRPTLLCVYERIPAASVPLVCSSLSAA-----LLPSLSSPPQCV 101 HN+E A N +L +++RIPA VPL+ + A +L L PP C+ Sbjct 203 HNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPEAGKPSDLILTRLLVPPLCI 262 > hsa:26696 OR2T1, OR1-25; olfactory receptor, family 2, subfamily T, member 1; K04257 olfactory receptor Length=369 Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query 1 RQFCWFFIYGIDLFGGILGNYGVTETGMSLPF 32 R+ CW I G FGG L + +T MS PF Sbjct 188 RRVCWMIIAG-SWFGGSLDGFLLTPITMSFPF 218 > mmu:211978 Zfyve26, 4930465A13, 9330197E15Rik, A630028O16Rik, Gm893, KIAA0321, mKIAA0321; zinc finger, FYVE domain containing 26 Length=2529 Score = 28.1 bits (61), Expect = 7.0, Method: Composition-based stats. Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 0/22 (0%) Query 83 CSSLSAALLPSLSSPPQCVTVK 104 CSSL+A LL SLSS P V V+ Sbjct 1150 CSSLAAVLLRSLSSDPDHVEVR 1171 Lambda K H 0.323 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2072286120 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40