bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_4484_orf1 Length=52 Score E Sequences producing significant alignments: (Bits) Value mmu:14886 Gtf2i, 6030441I21Rik, BAP-135, GtfII-I, Spin, TFII-I... 90.1 2e-18 hsa:2969 GTF2I, BAP135, BTKAP1, DIWS, FLJ38776, FLJ56355, GTFI... 89.7 2e-18 hsa:389524 GTF2IRD2B; GTF2I repeat domain containing 2B 36.6 0.019 hsa:84163 GTF2IRD2, FLJ21423, FLJ37938, FP630, GTF2IRD2A, MGC7... 36.6 0.020 hsa:6523 SLC5A1, D22S675, NAGT, SGLT1; solute carrier family 5... 29.3 2.8 > mmu:14886 Gtf2i, 6030441I21Rik, BAP-135, GtfII-I, Spin, TFII-I, WBSCR6; general transcription factor II I; K03121 transcription initiation factor TFII-I Length=998 Score = 90.1 bits (222), Expect = 2e-18, Method: Composition-based stats. Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 1/52 (1%) Query 1 AAVTLMEESEDPDYYQYNIQAGPSETDDVDDKLPLSKSLQGSHHSSEGNEGT 52 AAVT+ EESEDPDYYQYNIQ GPSETD VD+KLPLSK+LQGSHHSSEGNEGT Sbjct 235 AAVTVKEESEDPDYYQYNIQ-GPSETDGVDEKLPLSKALQGSHHSSEGNEGT 285 > hsa:2969 GTF2I, BAP135, BTKAP1, DIWS, FLJ38776, FLJ56355, GTFII-I, IB291, SPIN, TFII-I, WBS, WBSCR6; general transcription factor IIi; K03121 transcription initiation factor TFII-I Length=976 Score = 89.7 bits (221), Expect = 2e-18, Method: Composition-based stats. Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 1/52 (1%) Query 1 AAVTLMEESEDPDYYQYNIQAGPSETDDVDDKLPLSKSLQGSHHSSEGNEGT 52 AAVT+ EESEDPDYYQYNIQ GPSETDDVD+K PLSK LQGSHHSSEGNEGT Sbjct 235 AAVTVKEESEDPDYYQYNIQ-GPSETDDVDEKQPLSKPLQGSHHSSEGNEGT 285 > hsa:389524 GTF2IRD2B; GTF2I repeat domain containing 2B Length=949 Score = 36.6 bits (83), Expect = 0.019, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 3/37 (8%) Query 2 AVTLMEESEDPDYYQYNIQAG-PSETDD--VDDKLPL 35 AV++ +ESEDP+YYQYN+Q PS T + ++ +LP+ Sbjct 231 AVSVKKESEDPNYYQYNMQGSHPSSTSNEVIEMELPM 267 > hsa:84163 GTF2IRD2, FLJ21423, FLJ37938, FP630, GTF2IRD2A, MGC75203; GTF2I repeat domain containing 2 Length=949 Score = 36.6 bits (83), Expect = 0.020, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 28/37 (75%), Gaps = 3/37 (8%) Query 2 AVTLMEESEDPDYYQYNIQAG-PSETDD--VDDKLPL 35 AV++ +ESEDP+YYQYN+Q PS T + ++ +LP+ Sbjct 231 AVSVKKESEDPNYYQYNMQGSHPSSTSNEVIEMELPM 267 > hsa:6523 SLC5A1, D22S675, NAGT, SGLT1; solute carrier family 5 (sodium/glucose cotransporter), member 1; K14158 solute carrier family 5 (sodium/glucose cotransporter), member 1 Length=664 Score = 29.3 bits (64), Expect = 2.8, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 7 EESEDPDYYQYNIQAGPSETDDVDDKLPLSK 37 EE D D + NIQ GP ET +++ ++P K Sbjct 568 EERIDLDAEEENIQEGPKETIEIETQVPEKK 598 Lambda K H 0.299 0.122 0.335 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2022656792 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40