bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_4162_orf1 Length=71 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_018570 hypothetical protein ; K11883 RNA-binding pr... 62.0 5e-10 cpv:cgd7_1530 ART-4 protein; PIN+Zn ribbon domains. involved i... 43.5 2e-04 bbo:BBOV_IV004230 23.m06253; hypothetical protein; K11883 RNA-... 32.7 0.30 > tgo:TGME49_018570 hypothetical protein ; K11883 RNA-binding protein NOB1 Length=601 Score = 62.0 bits (149), Expect = 5e-10, Method: Composition-based stats. Identities = 26/55 (47%), Positives = 40/55 (72%), Gaps = 0/55 (0%) Query 8 VFDGKGKFSKRGQICTIPKNKGGKHQRPIIRLADQLMMGGLNRELRHREKLWKKD 62 V D + K S RG I ++PK +GG+H++ +I DQLMMGG +R LRH+++LW+ + Sbjct 484 VHDNRKKKSTRGNIHSLPKPRGGRHEKQLILAEDQLMMGGRDRLLRHQQRLWEAE 538 > cpv:cgd7_1530 ART-4 protein; PIN+Zn ribbon domains. involved in RNA metabolism ; K11883 RNA-binding protein NOB1 Length=404 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 0/48 (0%) Query 14 KFSKRGQICTIPKNKGGKHQRPIIRLADQLMMGGLNRELRHREKLWKK 61 K + RG I +IPK + G + II DQLMMGG R L H+ K W+K Sbjct 303 KVNLRGTIYSIPKPRRGVRNQEIILAEDQLMMGGRQRLLNHQRKKWEK 350 > bbo:BBOV_IV004230 23.m06253; hypothetical protein; K11883 RNA-binding protein NOB1 Length=381 Score = 32.7 bits (73), Expect = 0.30, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Query 2 ETGKVFVFDGKGKFSKRGQICTIPKNKGGKHQRPIIRLADQLMM---GGLNRELRHR 55 +TG+V V D + + RG I T PK GK ++ I DQLM+ G + RE+ + Sbjct 268 DTGEVKVKDTRKWINNRGTIYTQPKPVTGKSKQMYIVAEDQLMLPRYGHIIREMNRK 324 Lambda K H 0.323 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2020506228 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40