bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_4060_orf2 Length=129 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_097800 structural maintenance of chromosomes protei... 84.7 6e-17 bbo:BBOV_II001730 18.m06134; smc family/structural maintenance... 66.6 2e-11 pfa:MAL13P1.96 chromosome segregation protein, putative; K0667... 58.9 4e-09 tpv:TP04_0409 condensin subunit; K06674 structural maintenance... 52.4 4e-07 ath:AT5G62410 SMC2; SMC2 (STRUCTURAL MAINTENANCE OF CHROMOSOME... 49.7 2e-06 ath:AT3G47460 ATSMC2; ATSMC2; transporter; K06674 structural m... 47.8 8e-06 sce:YFR031C SMC2; Smc2p; K06674 structural maintenance of chro... 43.5 2e-04 xla:397800 smc2, SMC-2, xcap-e; structural maintenance of chro... 40.8 0.001 cel:F28B3.7 him-1; High Incidence of Males (increased X chromo... 40.8 0.001 hsa:10592 SMC2, CAP-E, CAPE, FLJ10093, SMC2L1, hCAP-E; structu... 39.3 0.003 dre:321452 smc2, SMC2L1, fb92e05, wu:fb92e05, zeh1628, zgc:553... 39.3 0.004 dre:100334001 structural maintenance of chromosomes 2-like; K0... 39.3 0.004 mmu:14211 Smc2, 5730502P04Rik, AI255214, AW545314, CAP-E, CAPE... 38.1 0.008 cpv:cgd4_2200 SMC2 protein ; K06674 structural maintenance of ... 37.7 0.009 xla:380182 smc1a, MGC53133, smc1aa, smc1l1; structural mainten... 37.0 0.014 xla:100379087 smc1ab, SMC-1A, smc1, smc1a, smc1l1, xSMC1; stru... 37.0 0.014 mmu:24061 Smc1a, 5830426I24Rik, KIAA0178, SMC-1A, Sb1.8, Smc1,... 37.0 0.014 hsa:8243 SMC1A, CDLS2, DKFZp686L19178, DXS423E, KIAA0178, MGC1... 37.0 0.014 dre:559665 smc1a; structural maintenance of chromosomes 1A; K0... 37.0 0.016 mmu:140557 Smc1b, SMC-1B, SMC1beta, Smc1l2; structural mainten... 33.1 0.20 xla:399092 smc3, Cspg6, xsmc3; structural maintenance of chrom... 32.3 0.36 bbo:BBOV_IV005990 23.m06059; hypothetical protein 30.8 1.1 hsa:27127 SMC1B, FLJ43748, SMC1BETA, SMC1L2, bK268H5, bK268H5.... 30.4 1.3 mmu:13006 Smc3, Bamacan, Cspg6, HCAP, Mmip1, SMC-3, SmcD; stru... 30.0 1.8 hsa:9126 SMC3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1; structura... 30.0 1.8 tpv:TP01_0677 ATP-specific succinyl-CoA synthetase beta subuni... 29.3 3.3 > tgo:TGME49_097800 structural maintenance of chromosomes protein, putative ; K06674 structural maintenance of chromosome 2 Length=1217 Score = 84.7 bits (208), Expect = 6e-17, Method: Composition-based stats. Identities = 45/71 (63%), Positives = 53/71 (74%), Gaps = 0/71 (0%) Query 18 YDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSV 77 +D RH KVA Y FGG LIC +A +A+KITYQ N R AFPT T EGDVFQTGG+MAGG Sbjct 618 FDANRHEKVALYTFGGSLICATAEMAEKITYQPNKRQAFPTVTVEGDVFQTGGVMAGGGS 677 Query 78 RDVRQTMLTWK 88 V++T+L WK Sbjct 678 GHVKETLLLWK 688 > bbo:BBOV_II001730 18.m06134; smc family/structural maintenance of chromosome; K06674 structural maintenance of chromosome 2 Length=1213 Score = 66.6 bits (161), Expect = 2e-11, Method: Composition-based stats. Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%) Query 22 RHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVR 81 + SK+A+Y G LIC S+ IA+KI YQK+ A+PTAT +GD F GG M+GGS + + Sbjct 639 KFSKLAKYLAGNSLICNSSQIARKIAYQKDRSRAYPTATLQGDKFDVGGSMSGGSNKGMH 698 Query 82 QTML 85 +L Sbjct 699 MVLL 702 > pfa:MAL13P1.96 chromosome segregation protein, putative; K06674 structural maintenance of chromosome 2 Length=1218 Score = 58.9 bits (141), Expect = 4e-09, Method: Composition-based stats. Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Query 15 LRRYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAG 74 + YD + ++ +Y F G LIC + + +KITY N +L++ T T EGD F T G M+G Sbjct 624 IMEYD-KNLERIIQYLFNGTLICSNVDLCKKITYNPNKKLSYTTITLEGDKFDTSGSMSG 682 Query 75 GSVRDVRQTMLTWK 88 GS +++ +L ++ Sbjct 683 GSNKNINLFLLNYE 696 > tpv:TP04_0409 condensin subunit; K06674 structural maintenance of chromosome 2 Length=1246 Score = 52.4 bits (124), Expect = 4e-07, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query 10 LALWALRRYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTG 69 L W + YD R ++ +Y G + C + A A+KI Y K + FPTAT +GD + Sbjct 617 LGYWEVFEYD-ERFLRLVQYVGGNCVFCSNDADARKIAYSKELKRRFPTATLQGDKYDIS 675 Query 70 GIMAGG 75 G M+GG Sbjct 676 GTMSGG 681 > ath:AT5G62410 SMC2; SMC2 (STRUCTURAL MAINTENANCE OF CHROMOSOMES 2); transporter; K06674 structural maintenance of chromosome 2 Length=1175 Score = 49.7 bits (117), Expect = 2e-06, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Query 28 EYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 EY FG +C++ +A+++ + ++ R P+ T EGD+FQ G++ GGS Sbjct 619 EYVFGSTFVCKTTDVAKEVAFNRDIRT--PSVTLEGDIFQPSGLLTGGS 665 > ath:AT3G47460 ATSMC2; ATSMC2; transporter; K06674 structural maintenance of chromosome 2 Length=1171 Score = 47.8 bits (112), Expect = 8e-06, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Query 28 EYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 EY FG +C++ A+++ + + R P+ T EGDVFQ G++ GGS Sbjct 616 EYVFGSTFVCKTTDAAKEVAFNREIRT--PSVTLEGDVFQPSGLLTGGS 662 > sce:YFR031C SMC2; Smc2p; K06674 structural maintenance of chromosome 2 Length=1170 Score = 43.5 bits (101), Expect = 2e-04, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Query 24 SKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQT 83 +K E+ FG LIC A+KIT+ R + T +GDV+ G ++GGS R+ ++ Sbjct 619 TKAMEFIFGNSLICEDPETAKKITFHPKIRAR--SITLQGDVYDPEGTLSGGS-RNTSES 675 Query 84 ML 85 +L Sbjct 676 LL 677 > xla:397800 smc2, SMC-2, xcap-e; structural maintenance of chromosomes 2; K06674 structural maintenance of chromosome 2 Length=1203 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 K EY FG L+C + A+K+T+ K R+ T T GD F G ++GG+ Sbjct 619 KAMEYVFGTTLVCDTMDNAKKVTFDK--RIMTKTVTLGGDTFDPQGTLSGGA 668 > cel:F28B3.7 him-1; High Incidence of Males (increased X chromosome loss) family member (him-1); K06636 structural maintenance of chromosome 1 Length=1262 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 3/83 (3%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQK-NCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQT 83 K ++ G L+C S A+++ Y + F + +G +FQ G+M+GGS D+RQ Sbjct 620 KALQFVCGNALVCESQEDAKQLAYGGGELKDRFKAVSMDGTLFQQSGVMSGGSA-DLRQK 678 Query 84 MLTWKVRQTARVIRIESNSLFPK 106 W + + +R + N L K Sbjct 679 SKKWD-EKVVKQLREKRNQLNEK 700 > hsa:10592 SMC2, CAP-E, CAPE, FLJ10093, SMC2L1, hCAP-E; structural maintenance of chromosomes 2; K06674 structural maintenance of chromosome 2 Length=1197 Score = 39.3 bits (90), Expect = 0.003, Method: Composition-based stats. Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQTM 84 K E+ FG +C + A+K+ + K R+ T T GDVF G ++GG+ R ++ Sbjct 618 KAMEFVFGTTFVCDNMDNAKKVAFDK--RIMTRTVTLGGDVFDPHGTLSGGA-RSQAASI 674 Query 85 LT--WKVRQTARVIRIESNSL 103 LT +++ +RI+ N L Sbjct 675 LTKFQELKDVQDELRIKENEL 695 > dre:321452 smc2, SMC2L1, fb92e05, wu:fb92e05, zeh1628, zgc:55326; structural maintenance of chromosomes 2; K06674 structural maintenance of chromosome 2 Length=1199 Score = 39.3 bits (90), Expect = 0.004, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 K EY FG L+C S A+K+ + K ++ T T GDVF G + GG+ Sbjct 618 KAMEYVFGTTLVCDSLDNAKKVAFDKG--VSTKTVTLGGDVFDPQGTLTGGA 667 > dre:100334001 structural maintenance of chromosomes 2-like; K06674 structural maintenance of chromosome 2 Length=1199 Score = 39.3 bits (90), Expect = 0.004, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 K EY FG L+C S A+K+ + K ++ T T GDVF G + GG+ Sbjct 618 KAMEYVFGTTLVCDSLDNAKKVAFDKG--VSTKTVTLGGDVFDPQGTLTGGA 667 > mmu:14211 Smc2, 5730502P04Rik, AI255214, AW545314, CAP-E, CAPE, Fin16, SMC-2, Smc2l1; structural maintenance of chromosomes 2; K06674 structural maintenance of chromosome 2 Length=1191 Score = 38.1 bits (87), Expect = 0.008, Method: Composition-based stats. Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQTM 84 K E+ FG +C + A+K+ + K R+ T T GDVF G ++GG+ R ++ Sbjct 618 KGMEFVFGTTFVCNNMDNAKKVAFDK--RIMTRTVTLGGDVFDPHGTLSGGA-RSQAASI 674 Query 85 LT--WKVRQTARVIRIESNSL 103 LT +V+ +R + N L Sbjct 675 LTKFQEVKDVQDELRTKENEL 695 > cpv:cgd4_2200 SMC2 protein ; K06674 structural maintenance of chromosome 2 Length=1236 Score = 37.7 bits (86), Expect = 0.009, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Query 28 EYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQTMLT 86 ++ FG +IC IA+ IT+ N + T T GD++ G ++GGS+ ++++L+ Sbjct 655 KFCFGHTIICEDENIAKMITF--NPGILARTVTLNGDIYDPSGTLSGGSIPSNQRSILS 711 > xla:380182 smc1a, MGC53133, smc1aa, smc1l1; structural maintenance of chromosomes 1A; K06636 structural maintenance of chromosome 1 Length=1232 Score = 37.0 bits (84), Expect = 0.014, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 RY+ K +YA G L+C + A++I + + R T +G +FQ G+++GG+ Sbjct 599 RYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQR--HKTVALDGTLFQKSGVISGGA 656 Query 77 VRDVRQTMLTW 87 D++ W Sbjct 657 -SDLKAKARRW 666 > xla:100379087 smc1ab, SMC-1A, smc1, smc1a, smc1l1, xSMC1; structural maintenance of chromosomes 1A b Length=1232 Score = 37.0 bits (84), Expect = 0.014, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 RY+ K +YA G L+C + A++I + + R T +G +FQ G+++GG+ Sbjct 599 RYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQR--HKTVALDGTLFQKSGVISGGA 656 Query 77 VRDVRQTMLTW 87 D++ W Sbjct 657 -SDLKAKARRW 666 > mmu:24061 Smc1a, 5830426I24Rik, KIAA0178, SMC-1A, Sb1.8, Smc1, Smc1alpha, Smc1l1, Smcb, mKIAA0178; structural maintenance of chromosomes 1A; K06636 structural maintenance of chromosome 1 Length=1233 Score = 37.0 bits (84), Expect = 0.014, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 RY+ K +YA G L+C + A++I + + R T +G +FQ G+++GG+ Sbjct 599 RYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQR--HKTVALDGTLFQKSGVISGGA 656 Query 77 VRDVRQTMLTW 87 D++ W Sbjct 657 -SDLKAKARRW 666 > hsa:8243 SMC1A, CDLS2, DKFZp686L19178, DXS423E, KIAA0178, MGC138332, SB1.8, SMC1, SMC1L1, SMC1alpha, SMCB; structural maintenance of chromosomes 1A; K06636 structural maintenance of chromosome 1 Length=1233 Score = 37.0 bits (84), Expect = 0.014, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 RY+ K +YA G L+C + A++I + + R T +G +FQ G+++GG+ Sbjct 599 RYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQR--HKTVALDGTLFQKSGVISGGA 656 Query 77 VRDVRQTMLTW 87 D++ W Sbjct 657 -SDLKAKARRW 666 > dre:559665 smc1a; structural maintenance of chromosomes 1A; K06636 structural maintenance of chromosome 1 Length=1232 Score = 37.0 bits (84), Expect = 0.016, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGS 76 RY+ K +YA G L+C + A++I + R T +G +FQ G+++GG+ Sbjct 599 RYEPPHIKKALQYACGNALVCENVEDARRIAFGGPYR--HKTVALDGTLFQKSGVISGGA 656 Query 77 VRDVRQTMLTW 87 D++ W Sbjct 657 -SDLKAKARRW 666 > mmu:140557 Smc1b, SMC-1B, SMC1beta, Smc1l2; structural maintenance of chromosomes 1B; K06636 structural maintenance of chromosome 1 Length=1248 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQTM 84 KV ++ G GL+C + A+ I + R +G +F G+++GGS D++ Sbjct 607 KVIQFVCGNGLVCETVEEARHIAFGGPERRK--AVALDGTLFLKSGVISGGS-SDLKHKA 663 Query 85 LTWKVRQ 91 L W ++ Sbjct 664 LCWDEKE 670 > xla:399092 smc3, Cspg6, xsmc3; structural maintenance of chromosomes 3; K06669 structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) Length=1217 Score = 32.3 bits (72), Expect = 0.36, Method: Composition-based stats. Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 18/108 (16%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKI--TYQKNCRLAFPTATAEGDVFQTGGIMAG 74 RY++R K ++ FG LICRS ++ ++ + +C T EGD G + G Sbjct 614 RYNLR-FDKAFKHVFGKTLICRSMEVSTQLARAFTMDC------ITLEGDQVSHRGALTG 666 Query 75 GSVRDVRQTMLTWKVRQTARVIRIESNSLFPKFRLYGAAEESLRLGTE 122 G D R++ L ++++ R + E ++L K E+LR E Sbjct 667 G-YYDTRKSRL--ELQKDVRKVEDELHALEAKL------NENLRRNIE 705 > bbo:BBOV_IV005990 23.m06059; hypothetical protein Length=86 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query 84 MLTWKVRQTARVIRIESNSLFPKFRLY--GAAEESLRLGTECG 124 ML +R+ +RV + S P FR Y AEE LRL ECG Sbjct 4 MLQRLLREVSRVREVASTFSNPVFRNYFVSKAEEELRLLKECG 46 > hsa:27127 SMC1B, FLJ43748, SMC1BETA, SMC1L2, bK268H5, bK268H5.5; structural maintenance of chromosomes 1B; K06636 structural maintenance of chromosome 1 Length=1235 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query 25 KVAEYAFGGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDVRQTM 84 KV ++ G GL+C + A+ I R T +G +F G+++GGS D++ Sbjct 607 KVIQFVCGNGLVCETMEEARHIALSGPERQK--TVALDGTLFLKSGVISGGS-SDLKYKA 663 Query 85 LTWKVRQ 91 W ++ Sbjct 664 RCWDEKE 670 > mmu:13006 Smc3, Bamacan, Cspg6, HCAP, Mmip1, SMC-3, SmcD; structural maintenace of chromosomes 3; K06669 structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) Length=1217 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 10/71 (14%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKI--TYQKNCRLAFPTATAEGDVFQTGGIMAG 74 RY+ R K ++ FG LICRS ++ ++ + +C T EGD G + G Sbjct 614 RYN-PRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDC------ITLEGDQVSHRGALTG 666 Query 75 GSVRDVRQTML 85 G D R++ L Sbjct 667 G-YYDTRKSRL 676 > hsa:9126 SMC3, BAM, BMH, CDLS3, CSPG6, HCAP, SMC3L1; structural maintenance of chromosomes 3; K06669 structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6) Length=1217 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 10/71 (14%) Query 17 RYDVRRHSKVAEYAFGGGLICRSAAIAQKI--TYQKNCRLAFPTATAEGDVFQTGGIMAG 74 RY+ R K ++ FG LICRS ++ ++ + +C T EGD G + G Sbjct 614 RYN-PRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDC------ITLEGDQVSHRGALTG 666 Query 75 GSVRDVRQTML 85 G D R++ L Sbjct 667 G-YYDTRKSRL 676 > tpv:TP01_0677 ATP-specific succinyl-CoA synthetase beta subunit; K01900 succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5] Length=453 Score = 29.3 bits (64), Expect = 3.3, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 0/49 (0%) Query 32 GGGLICRSAAIAQKITYQKNCRLAFPTATAEGDVFQTGGIMAGGSVRDV 80 G GL+C +AQK++ + L+F G + GG+V ++ Sbjct 127 GKGLLCTEVLVAQKLSIKSERYLSFTLDRGSGGIVAIATKHGGGNVEEI 175 Lambda K H 0.325 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2044474180 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40