bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3757_orf1 Length=103 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_110640 uridine phosphorylase, putative (EC:2.4.2.1)... 63.2 2e-10 eco:b4384 deoD, ECK4376, JW4347, pup; purine-nucleoside phosph... 37.4 0.011 tgo:TGME49_020280 SCP-like domain-containing protein 33.1 0.24 eco:b1978 yeeJ, ECK1974, JW5833; probable adhesin; K13735 adhe... 30.0 1.9 ath:AT1G27720 TAF4B; TAF4B (TBP-ASSOCIATED FACTOR 4B); transcr... 28.1 8.0 > tgo:TGME49_110640 uridine phosphorylase, putative (EC:2.4.2.1); K00757 uridine phosphorylase [EC:2.4.2.3] Length=303 Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 0/61 (0%) Query 38 KEAEIFLNEDGSLYHLGVKSGELHPRILTVGDRERAQMIAEAFLEQVREFEKSRNFRTFS 97 K IFL DG YHLGVK G+L I+TVG +RA+++A FL V E SR F TF+ Sbjct 5 KGKNIFLTPDGRTYHLGVKKGDLASLIVTVGCEQRARVLAAKFLTDVTEVSSSRQFYTFT 64 Query 98 G 98 G Sbjct 65 G 65 > eco:b4384 deoD, ECK4376, JW4347, pup; purine-nucleoside phosphorylase (EC:2.4.2.1); K03784 purine-nucleoside phosphorylase [EC:2.4.2.1] Length=239 Score = 37.4 bits (85), Expect = 0.011, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 0/47 (0%) Query 52 HLGVKSGELHPRILTVGDRERAQMIAEAFLEQVREFEKSRNFRTFSG 98 H+ + G+ +L GD RA+ IAE FLE RE R F+G Sbjct 5 HINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTG 51 > tgo:TGME49_020280 SCP-like domain-containing protein Length=434 Score = 33.1 bits (74), Expect = 0.24, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Query 51 YHLGVKSGELHPRI--LTVGDRERAQMIAEAFL----EQVREFEKSRN 92 YH + +L PR+ LT GD+ERA +AF+ E V E ++ RN Sbjct 62 YHDAKRGRQLSPRLSELTTGDKERASQRLQAFIDNGCEDVVEVDECRN 109 > eco:b1978 yeeJ, ECK1974, JW5833; probable adhesin; K13735 adhesin/invasin Length=2358 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 0/32 (0%) Query 66 TVGDRERAQMIAEAFLEQVREFEKSRNFRTFS 97 T+G E AQ +AE F V E K FRTF+ Sbjct 72 TLGALESAQSVAERFGISVAELRKLNQFRTFA 103 > ath:AT1G27720 TAF4B; TAF4B (TBP-ASSOCIATED FACTOR 4B); transcription initiation factor Length=720 Score = 28.1 bits (61), Expect = 8.0, Method: Compositional matrix adjust. Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query 12 RGVHTSQHCAGFAKTPTSSFSQKMAEKEAEIFLNEDGSLYHLGVKSGELHP----RILTV 67 R VH +Q + + T SS + + K E + S +H+ KSG L+P + + Sbjct 178 REVHVNQLSSTTSGTLNSSTTVQGLNKHPEQHMQLPSSSFHMDTKSGSLNPYPGTNVTSP 237 Query 68 GDRERAQM 75 G RA++ Sbjct 238 GSSSRAKL 245 Lambda K H 0.321 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2027061836 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40