bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_3030_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_024950 protein kinase 6, putative (EC:1.6.3.1 2.7.1... 76.6 2e-14 hsa:9889 ZBED4; zinc finger, BED-type containing 4 28.5 cel:C15F1.3 tra-2; TRAnsformer : XX animals transformed into m... 28.5 5.8 dre:560281 flii, im:7141769; flightless I homolog (Drosophila) 28.1 6.7 cel:C18H9.8 ift-74; IFT (Chlamydomonas IntraFlagellar Transpor... 27.7 9.6 > tgo:TGME49_024950 protein kinase 6, putative (EC:1.6.3.1 2.7.11.17); K13412 calcium-dependent protein kinase [EC:2.7.11.1] Length=681 Score = 76.6 bits (187), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/67 (56%), Positives = 45/67 (67%), Gaps = 8/67 (11%) Query 64 ADHHCHG-----PEEKPHFFSLCTKCATDGKDKPL---REPAKGFITRSESYVNASAASR 115 AD+ C G KPHFFSLCTKCA +GKDK REP +G I RSES++NAS ASR Sbjct 92 ADYGCRGGDCCDTSTKPHFFSLCTKCANEGKDKSQHDRREPVRGLIIRSESFMNASEASR 151 Query 116 WEVDELC 122 WE++ C Sbjct 152 WEIEAQC 158 > hsa:9889 ZBED4; zinc finger, BED-type containing 4 Length=1171 Score = 28.5 bits (62), Expect = 5.3, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query 33 GGPPASNMQKDKRLDTAEGRPLESPCRPNCAADHHC 68 G SN ++ TA ESP RP C DHHC Sbjct 732 SGIWMSNQTREYLTLTAHWVSFESPARPRC-DDHHC 766 > cel:C15F1.3 tra-2; TRAnsformer : XX animals transformed into males family member (tra-2) Length=1475 Score = 28.5 bits (62), Expect = 5.8, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query 57 PCRPNCAAD-HHCHGPEEKPHFFSLCT 82 P + CAA H C P + H+F++CT Sbjct 238 PRQKTCAASIHSCDTPLDSEHYFNICT 264 > dre:560281 flii, im:7141769; flightless I homolog (Drosophila) Length=1259 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 0/26 (0%) Query 21 GAEPRPAAAGGGGGPPASNMQKDKRL 46 GA P AA GGG P +M + RL Sbjct 404 GASPATVAAAGGGNSPRDHMARKMRL 429 > cel:C18H9.8 ift-74; IFT (Chlamydomonas IntraFlagellar Transport) homolog family member (ift-74) Length=674 Score = 27.7 bits (60), Expect = 9.6, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 0/47 (0%) Query 14 PDSPDGEGAEPRPAAAGGGGGPPASNMQKDKRLDTAEGRPLESPCRP 60 P P G P P GGPP + R T RP + RP Sbjct 114 PVPPSRSGGPPAPMPVSRAGGPPRAPTSMGGRPMTGMARPPTAGLRP 160 Lambda K H 0.310 0.131 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2105161088 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40