bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2342_orf1 Length=114 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_022860 eukaryotic translation initiation factor 3 s... 70.9 1e-12 tpv:TP04_0268 hypothetical protein; K03253 translation initiat... 56.6 2e-08 cpv:cgd2_360 prtip-like IF39 eukaryotic translation initiation... 51.2 8e-07 bbo:BBOV_II003250 18.m06273; eukaryotic translation initiation... 49.7 2e-06 pfa:PFE0885w eukaryotictranslation initiation factor 3 subunit... 45.4 4e-05 cel:Y54E2A.11 eif-3.B; Eukaryotic Initiation Factor family mem... 35.8 0.037 cel:R07E3.5 acl-5; ACyLtransferase-like family member (acl-5);... 35.4 0.051 xla:379798 scarb2, MGC53174, cd36l2; scavenger receptor class ... 33.5 0.16 mmu:17174 Masp1, AW048060, CCPII, Crarf, Masp1/3; mannan-bindi... 32.0 0.44 dre:796380 eif3b, eif3s9, wu:fc17c01; eukaryotic translation i... 30.8 1.00 pfa:PF13_0071 probable protein, unknown function 30.4 1.5 dre:100002875 MGC162585, im:6909100; si:dkey-44g23.7 (EC:1.14.... 29.6 2.5 xla:735075 eif3b, MGC99017, eIF-3-eta; eukaryotic translation ... 29.3 3.1 tgo:TGME49_012850 hypothetical protein 28.9 4.5 dre:100150342 si:dkey-177p2.10; si:dkey-177p2.16 28.1 6.7 dre:541505 cep68, si:ch211-101n13.4, si:zc101n13.4, zgc:112945... 28.1 7.2 eco:b3987 rpoB, ECK3978, ftsR, groN, JW3950, mbrD?, nitB, rif,... 28.1 7.5 > tgo:TGME49_022860 eukaryotic translation initiation factor 3 subunit 9, putative ; K03253 translation initiation factor 3 subunit B Length=756 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 47/102 (46%), Positives = 66/102 (64%), Gaps = 14/102 (13%) Query 16 MVKVTKEDLEKLEIKEEEQEELLKYISDDSD--------EDEEALTKKLEAFEPLLQMDD 67 MV++ K+DL E+++LL+++S+DSD + EE L +KL EPLLQMD Sbjct 1 MVRIDKDDLPA------EEQDLLEFLSEDSDEGEDDDSEQGEEKLKEKLSQMEPLLQMDY 54 Query 68 RFPDTVIMVGVPLVGADRLEKLTAVLRKKIADELSRKGGEDV 109 FP T+++VGVP VG D+ EKL VL KK+ +EL +KG E V Sbjct 55 SFPSTIVLVGVPKVGKDKHEKLRLVLDKKMGEELLKKGAESV 96 > tpv:TP04_0268 hypothetical protein; K03253 translation initiation factor 3 subunit B Length=731 Score = 56.6 bits (135), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 32/92 (34%), Positives = 57/92 (61%), Gaps = 4/92 (4%) Query 16 MVKVTKEDLEKLEIKEEEQEELLKYISDDSDEDEEALTKKLEAFEPLLQMDDRFPDTVIM 75 MVKV+ DL + EE + LL ++SDD +E +++ + +P + +D F T+++ Sbjct 1 MVKVSPSDLSQ----EELEIGLLDWVSDDDEEFDKSQLDRFYELDPPVTLDKSFKRTLMV 56 Query 76 VGVPLVGADRLEKLTAVLRKKIADELSRKGGE 107 +G+P+VG ++ ++L V+RK I EL +KG E Sbjct 57 LGLPVVGPEKHDRLRDVVRKTITKELEKKGCE 88 > cpv:cgd2_360 prtip-like IF39 eukaryotic translation initiation factor 3 ; K03253 translation initiation factor 3 subunit B Length=724 Score = 51.2 bits (121), Expect = 8e-07, Method: Composition-based stats. Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 10/89 (11%) Query 16 MVKVTKEDLEKLEIKEEEQEELLKYISD---DSDEDEEALTKKLEAFEPLLQMDDRFPDT 72 M KVT+E+L E +LL+Y+SD D +E EE ++K+ E L + D F + Sbjct 1 MFKVTREELG-------EDIDLLEYLSDSTYDGEETEEYISKRCNTIEEPLTLSDSFSKS 53 Query 73 VIMVGVPLVGADRLEKLTAVLRKKIADEL 101 ++ G+P +G+D+ E+ LR I L Sbjct 54 FVIFGLPCIGSDKYERFLKALRTIINQTL 82 > bbo:BBOV_II003250 18.m06273; eukaryotic translation initiation factor 3 subunit; K03253 translation initiation factor 3 subunit B Length=732 Score = 49.7 bits (117), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/90 (30%), Positives = 53/90 (58%), Gaps = 4/90 (4%) Query 16 MVKVTKEDLEKLEIKEEEQEELLKYISDDSDEDEEALTKKLEAFEPLLQMDDRFPDTVIM 75 MV + + DL E+ + L++++SD D +E ++L E +++ FP+T+I+ Sbjct 1 MVVIRESDLSA----EDLADGLMEWMSDHDDSKDEEEMERLALMEHPIELSTIFPNTIIV 56 Query 76 VGVPLVGADRLEKLTAVLRKKIADELSRKG 105 G+PLV ++ ++L +LRKK+ + +KG Sbjct 57 TGLPLVTQEKYDRLMEILRKKLLKDFEKKG 86 > pfa:PFE0885w eukaryotictranslation initiation factor 3 subunit, putative; K03253 translation initiation factor 3 subunit B Length=716 Score = 45.4 bits (106), Expect = 4e-05, Method: Composition-based stats. Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 9/90 (10%) Query 16 MVKVTKEDLEKLEIKEEEQEELLKYISDDSDE-DEEALTKKLEAFEPLLQMDDRFPDTVI 74 MV+V+ +L +EL+ ++S+DSD DE L KK E L+ ++ FP V Sbjct 1 MVRVSDNELS--------DKELVDFLSEDSDNGDENLLNKKYSDKEALITLEVDFPKIVT 52 Query 75 MVGVPLVGADRLEKLTAVLRKKIADELSRK 104 ++G+P V +++ +L VL+K LS K Sbjct 53 ILGIPKVESEKHGRLAEVLKKLFIRHLSAK 82 > cel:Y54E2A.11 eif-3.B; Eukaryotic Initiation Factor family member (eif-3.B); K03253 translation initiation factor 3 subunit B Length=725 Score = 35.8 bits (81), Expect = 0.037, Method: Compositional matrix adjust. Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%) Query 71 DTVIMVGVPLVGADRLEKLTAVLRK 95 + V + G+P+VGADRL KL +VL+K Sbjct 46 NCVFIAGIPVVGADRLGKLQSVLKK 70 > cel:R07E3.5 acl-5; ACyLtransferase-like family member (acl-5); K13506 glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15] Length=512 Score = 35.4 bits (80), Expect = 0.051, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Query 29 IKEEEQEELLKYISDDSDEDEEALTKKLEAFEPLLQMDDRFPDTVI 74 I EEE++ELLK I D +DEE + +K+ + +P ++ D D I Sbjct 466 ISEEERDELLKQI--DEQDDEEEMIRKISSLKPKFKIGDHDADEHI 509 > xla:379798 scarb2, MGC53174, cd36l2; scavenger receptor class B, member 2; K12384 lysosome membrane protein 2 Length=484 Score = 33.5 bits (75), Expect = 0.16, Method: Composition-based stats. Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 5/96 (5%) Query 5 FHVFGAENPEKMVKVTK---EDLEKLEIKEEEQEELLKYISDDSDEDEEALTKKLEAFEP 61 F+ F NP +++ K ++ +E Q+E + + ++++ A+T K FEP Sbjct 64 FYFFNVNNPLEILNGEKPFVTEIGPYTYREYRQKENITFSVNETEV--SAVTPKTYVFEP 121 Query 62 LLQMDDRFPDTVIMVGVPLVGADRLEKLTAVLRKKI 97 + + D D + V +PLV + K + +LR I Sbjct 122 EMSVGDPKVDLIRTVNIPLVTVMEMTKDSRILRPLI 157 > mmu:17174 Masp1, AW048060, CCPII, Crarf, Masp1/3; mannan-binding lectin serine peptidase 1 (EC:3.4.21.-); K03992 mannan-binding lectin serine protease 1 [EC:3.4.21.-] Length=704 Score = 32.0 bits (71), Expect = 0.44, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Query 64 QMDDRFPDTVIMVGVPLVGADRLEKLTAVLRKKIADEL----SRKGGED 108 Q RFP+ ++ + +P+V +D ++ L+KK+ ++ ++GG+D Sbjct 597 QFLQRFPENLMEIEIPIVNSDTCQEAYTPLKKKVTKDMICAGEKEGGKD 645 > dre:796380 eif3b, eif3s9, wu:fc17c01; eukaryotic translation initiation factor 3, subunit B; K03253 translation initiation factor 3 subunit B Length=681 Score = 30.8 bits (68), Expect = 1.00, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Query 71 DTVIMV-GVPLVGADRLEKLTAVLRK 95 D+VI+V VP VG DRLEKL V+ K Sbjct 52 DSVIVVDNVPQVGPDRLEKLKNVIHK 77 > pfa:PF13_0071 probable protein, unknown function Length=562 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 43 DDSDEDEEALTKKLEAFEPLLQMDDRFP 70 +D D++E A TK L A + LL +DD FP Sbjct 379 EDEDDEEYATTKFLRAHDILLSVDDHFP 406 > dre:100002875 MGC162585, im:6909100; si:dkey-44g23.7 (EC:1.14.99.3); K00510 heme oxygenase [EC:1.14.99.3] Length=310 Score = 29.6 bits (65), Expect = 2.5, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 1 GLAFFHVFGAENPEKMVKVTKEDLEKLEIKEEEQEELL 38 GL F+H G NP ++ + + +LE+ E + +LL Sbjct 178 GLNFYHFEGIHNPTAFKRLYRSRMNELEVDAETKAKLL 215 > xla:735075 eif3b, MGC99017, eIF-3-eta; eukaryotic translation initiation factor 3, subunit B; K03253 translation initiation factor 3 subunit B Length=688 Score = 29.3 bits (64), Expect = 3.1, Method: Compositional matrix adjust. Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Query 71 DTVIMV-GVPLVGADRLEKLTAVLRK 95 D+VI+V VP VG DRLEKL V+ K Sbjct 60 DSVIVVDNVPQVGPDRLEKLKNVIVK 85 > tgo:TGME49_012850 hypothetical protein Length=414 Score = 28.9 bits (63), Expect = 4.5, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query 41 ISDDSDEDEEALTKKLEAFEPLLQMDDRFPD-TVIMVGVPLVGADRLEKLTAVLRKKI 97 +SD + E LEA EP+L++D R + V++ G+D E+ TA LR I Sbjct 156 VSDGTQEGVLTAEFPLEAAEPILELDSRRTERKVVLSADTGEGSDAPEEETAALRSTI 213 > dre:100150342 si:dkey-177p2.10; si:dkey-177p2.16 Length=355 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 5/100 (5%) Query 11 ENPEKMVKV--TKEDLEK-LEIKEEEQEELLKYISDDSDEDEEALTKKLEAFEPLLQMDD 67 E EK +K+ T+ ++K ++ KE+E + + IS SD +A+ +AF L+++ + Sbjct 181 ERKEKELKLSDTQTKVKKTIQAKEKELQNMKMDISSHSDSALKAIKNSKKAFAELVKLIE 240 Query 68 RFPDTVI--MVGVPLVGADRLEKLTAVLRKKIADELSRKG 105 + VI + D EK+ L+ +IAD R+G Sbjct 241 KKSSEVIEKIKAQEKADLDEGEKIQEKLKGEIADLKKREG 280 > dre:541505 cep68, si:ch211-101n13.4, si:zc101n13.4, zgc:112945; centrosomal protein 68 Length=650 Score = 28.1 bits (61), Expect = 7.2, Method: Composition-based stats. Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 14/90 (15%) Query 6 HVFGAENPEKMVKVTKEDLEKLEIKEEEQ----------EELLKYISDDSDEDEEALTKK 55 H+ E P +++ +DL + ++E E EL + D +E +E+L + Sbjct 504 HLLKTEEPPTSIQMISQDLNRNNLREVEAIMDQLRGLSVSELQGTMQTDENETKESLMQH 563 Query 56 LEAF----EPLLQMDDRFPDTVIMVGVPLV 81 ++AF E L+Q + + V ++ P V Sbjct 564 IQAFCSNLEVLIQWLHKVVEKVELLSPPTV 593 > eco:b3987 rpoB, ECK3978, ftsR, groN, JW3950, mbrD?, nitB, rif, ron, sdgB, stl, stv, tabD, tabG; RNA polymerase, beta subunit (EC:2.7.7.6); K03043 DNA-directed RNA polymerase subunit beta [EC:2.7.7.6] Length=1342 Score = 28.1 bits (61), Expect = 7.5, Method: Compositional matrix adjust. Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Query 7 VFGAENPEKMVKVTKEDLEKLEIKEEEQEELLKYISDDSDEDEEALTKKLEA-FEPLLQM 65 V G EK+ K+ ++ +L + +EE++ L+ +++ DE + KKLEA + Q Sbjct 980 VAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQG 1039 Query 66 DDRFPDTVIMVGVPLVGADRLE 87 DD P + +V V L R++ Sbjct 1040 DDLAPGVLKIVKVYLAVKRRIQ 1061 Lambda K H 0.312 0.136 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2047611720 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40