bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2315_orf1 Length=70 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_023050 40s ribosomal protein S20, putative ; K02969... 62.4 4e-10 pfa:PF10_0038 40S ribosomal protein S20e, putative; K02969 sma... 39.3 0.003 cpv:cgd7_5060 40S ribosomal protein S20 ; K02969 small subunit... 36.2 0.026 ath:AT3G47370 40S ribosomal protein S20 (RPS20B) 35.8 0.032 tpv:TP04_0162 40S ribosomal protein S20; K02969 small subunit ... 35.0 0.053 ath:AT5G62300 40S ribosomal protein S20 (RPS20C); K02969 small... 33.5 0.19 ath:AT3G45030 40S ribosomal protein S20 (RPS20A) 33.5 0.19 xla:100101334 hypothetical protein LOC100101334 32.3 0.35 xla:444801 MGC82136 protein; K02969 small subunit ribosomal pr... 31.6 0.61 xla:379094 rps20, MGC52591; ribosomal protein S20; K02969 smal... 31.6 0.63 dre:406485 rps20, wu:fb81b03, zgc:77758; ribosomal protein S20... 31.2 0.94 mmu:67427 Rps20, 4632426K06Rik, Dsk4, MGC102408; ribosomal pro... 30.8 0.99 hsa:6224 RPS20, FLJ27451, MGC102930; ribosomal protein S20; K0... 30.8 0.99 tgo:TGME49_069950 hypothetical protein 30.8 1.0 mmu:100043278 Gm4332; predicted gene 4332 30.8 xla:447108 anxa8, MGC85309, anx8; annexin A8 29.3 2.9 bbo:BBOV_II004020 18.m06332; 40S ribosomal protein S20; K02969... 29.3 3.2 ath:AT1G12220 RPS5; RPS5 (RESISTANT TO P. SYRINGAE 5); nucleot... 28.9 3.8 dre:562437 ubfd1, MGC162578, im:6905175, zgc:162578; ubiquitin... 28.1 7.0 mmu:28018 Ubfd1, AI467302, D7Wsu105e, D7Wsu128e, Ubph; ubiquit... 27.7 9.3 > tgo:TGME49_023050 40s ribosomal protein S20, putative ; K02969 small subunit ribosomal protein S20e Length=233 Score = 62.4 bits (150), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 0/35 (0%) Query 10 ASMSKALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 A MSK +K GLEGEEQRLHRIRITLTSKDLKSIER Sbjct 114 AKMSKLMKGGLEGEEQRLHRIRITLTSKDLKSIER 148 > pfa:PF10_0038 40S ribosomal protein S20e, putative; K02969 small subunit ribosomal protein S20e Length=118 Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/33 (54%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 12 MSKALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 MSK +K ++ E+ RL RIRI LTSK+L++IE+ Sbjct 1 MSKLMKGAIDNEKYRLRRIRIALTSKNLRAIEK 33 > cpv:cgd7_5060 40S ribosomal protein S20 ; K02969 small subunit ribosomal protein S20e Length=135 Score = 36.2 bits (82), Expect = 0.026, Method: Compositional matrix adjust. Identities = 18/27 (66%), Positives = 23/27 (85%), Gaps = 2/27 (7%) Query 20 LEGEEQR--LHRIRITLTSKDLKSIER 44 GE+Q+ LH+IRITL+SK+LKSIER Sbjct 24 FNGEQQQAPLHKIRITLSSKNLKSIER 50 > ath:AT3G47370 40S ribosomal protein S20 (RPS20B) Length=122 Score = 35.8 bits (81), Expect = 0.032, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 27/37 (72%), Gaps = 0/37 (0%) Query 8 LAASMSKALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 +A K K GLE +++H+IRITL+SK++K++E+ Sbjct 1 MAYEPMKPTKAGLEAPLEQIHKIRITLSSKNVKNLEK 37 > tpv:TP04_0162 40S ribosomal protein S20; K02969 small subunit ribosomal protein S20e Length=116 Score = 35.0 bits (79), Expect = 0.053, Method: Compositional matrix adjust. Identities = 15/27 (55%), Positives = 21/27 (77%), Gaps = 0/27 (0%) Query 19 GLEGEEQRLHRIRITLTSKDLKSIERG 45 G E+ R+H+IR+TL S+DLKSIE+ Sbjct 9 GEYDEDNRIHKIRLTLVSRDLKSIEKA 35 > ath:AT5G62300 40S ribosomal protein S20 (RPS20C); K02969 small subunit ribosomal protein S20e Length=124 Score = 33.5 bits (75), Expect = 0.19, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 0/31 (0%) Query 14 KALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 K K GLE +++H+IRITL+SK++K++E+ Sbjct 9 KPGKAGLEEPLEQIHKIRITLSSKNVKNLEK 39 > ath:AT3G45030 40S ribosomal protein S20 (RPS20A) Length=124 Score = 33.5 bits (75), Expect = 0.19, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 25/31 (80%), Gaps = 0/31 (0%) Query 14 KALKEGLEGEEQRLHRIRITLTSKDLKSIER 44 K K GLE +++H+IRITL+SK++K++E+ Sbjct 9 KPGKAGLEEPLEQIHKIRITLSSKNVKNLEK 39 > xla:100101334 hypothetical protein LOC100101334 Length=120 Score = 32.3 bits (72), Expect = 0.35, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 23/27 (85%), Gaps = 0/27 (0%) Query 18 EGLEGEEQRLHRIRITLTSKDLKSIER 44 + L ++Q++HRIRITLTS ++K++E+ Sbjct 8 KALAEDDQQIHRIRITLTSLNVKNLEK 34 > xla:444801 MGC82136 protein; K02969 small subunit ribosomal protein S20e Length=119 Score = 31.6 bits (70), Expect = 0.61, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 20/22 (90%), Gaps = 0/22 (0%) Query 23 EEQRLHRIRITLTSKDLKSIER 44 +E +HRIRITLTS+++KS+E+ Sbjct 13 QEVAIHRIRITLTSRNVKSLEK 34 > xla:379094 rps20, MGC52591; ribosomal protein S20; K02969 small subunit ribosomal protein S20e Length=119 Score = 31.6 bits (70), Expect = 0.63, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 20/22 (90%), Gaps = 0/22 (0%) Query 23 EEQRLHRIRITLTSKDLKSIER 44 +E +HRIRITLTS+++KS+E+ Sbjct 13 QEVAIHRIRITLTSRNVKSLEK 34 > dre:406485 rps20, wu:fb81b03, zgc:77758; ribosomal protein S20; K02969 small subunit ribosomal protein S20e Length=119 Score = 31.2 bits (69), Expect = 0.94, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 19/21 (90%), Gaps = 0/21 (0%) Query 24 EQRLHRIRITLTSKDLKSIER 44 E +HRIRITLTS+++KS+E+ Sbjct 14 EVAIHRIRITLTSRNVKSLEK 34 > mmu:67427 Rps20, 4632426K06Rik, Dsk4, MGC102408; ribosomal protein S20; K02969 small subunit ribosomal protein S20e Length=119 Score = 30.8 bits (68), Expect = 0.99, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 19/21 (90%), Gaps = 0/21 (0%) Query 24 EQRLHRIRITLTSKDLKSIER 44 E +HRIRITLTS+++KS+E+ Sbjct 14 EVAIHRIRITLTSRNVKSLEK 34 > hsa:6224 RPS20, FLJ27451, MGC102930; ribosomal protein S20; K02969 small subunit ribosomal protein S20e Length=119 Score = 30.8 bits (68), Expect = 0.99, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 19/21 (90%), Gaps = 0/21 (0%) Query 24 EQRLHRIRITLTSKDLKSIER 44 E +HRIRITLTS+++KS+E+ Sbjct 14 EVAIHRIRITLTSRNVKSLEK 34 > tgo:TGME49_069950 hypothetical protein Length=944 Score = 30.8 bits (68), Expect = 1.0, Method: Compositional matrix adjust. Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 7/62 (11%) Query 1 FIHPFSSLAASMSKALKEGLEGEE-QRLHRIRITLTSKDLKSIERGEQQRKNDISAFLEV 59 F+ P+ SL ++ KE L EE + LHR +D ++ RGE +R+ D+S +E Sbjct 554 FLGPYDSLTVFATQKYKELLRQEEHEHLHR-----QDRDTPNL-RGESRRETDVSFMIEA 607 Query 60 LK 61 L+ Sbjct 608 LE 609 > mmu:100043278 Gm4332; predicted gene 4332 Length=115 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 19/21 (90%), Gaps = 0/21 (0%) Query 24 EQRLHRIRITLTSKDLKSIER 44 E +HRIRITLTS+++KS+E+ Sbjct 10 EVAIHRIRITLTSRNVKSLEK 30 > xla:447108 anxa8, MGC85309, anx8; annexin A8 Length=363 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query 6 SSLAASMSKALKEGLEGEEQRLHRIRITLTSKDLKSI-ERGEQQRKNDISAFLEVL 60 S + KAL L+GE + L +D K++ E GE+ +K D+S F+E+ Sbjct 187 SDTSGDFQKALLILLKGERNEDCYVNEDLAERDAKALYEAGEKNKKADVSVFIEIF 242 > bbo:BBOV_II004020 18.m06332; 40S ribosomal protein S20; K02969 small subunit ribosomal protein S20e Length=120 Score = 29.3 bits (64), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 25 QRLHRIRITLTSKDLKSIERG 45 R+H+I +TLTS +LK+IE+ Sbjct 19 NRIHKIHVTLTSMNLKAIEKA 39 > ath:AT1G12220 RPS5; RPS5 (RESISTANT TO P. SYRINGAE 5); nucleotide binding; K13460 disease resistance protein RPS5 Length=889 Score = 28.9 bits (63), Expect = 3.8, Method: Compositional matrix adjust. Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 15/85 (17%) Query 1 FIHPFSSLAASMSKALK---------------EGLEGEEQRLHRIRITLTSKDLKSIERG 45 +IH S AS+ KA++ E G +QRL ++++ LTS + + Sbjct 28 YIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFN 87 Query 46 EQQRKNDISAFLEVLKPFCSRYMGL 70 + R N++ L FCS+ + L Sbjct 88 DLLRSNEVELQRLCLCGFCSKDLKL 112 > dre:562437 ubfd1, MGC162578, im:6905175, zgc:162578; ubiquitin family domain containing 1 Length=279 Score = 28.1 bits (61), Expect = 7.0, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 2 IHPFSSLAASMSKALKEGLEGEEQRLHRIRITLTSK 37 IH + L +M K + +GL EE+ L I++T +K Sbjct 84 IHALTGLPPAMQKVMYKGLLPEEKTLREIKVTNGAK 119 > mmu:28018 Ubfd1, AI467302, D7Wsu105e, D7Wsu128e, Ubph; ubiquitin family domain containing 1 Length=368 Score = 27.7 bits (60), Expect = 9.3, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 2 IHPFSSLAASMSKALKEGLEGEEQRLHRIRITLTSK 37 IH + L +M K + +GL E++ L I++T +K Sbjct 173 IHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAK 208 Lambda K H 0.320 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2024947620 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40