bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2300_orf1 Length=196 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_111750 hypothetical protein ; K14294 partner of Y14... 87.8 2e-17 ath:AT1G11400 PYM; PYM (Partner of Y14-Mago); protein binding;... 60.5 4e-09 tpv:TP03_0719 hypothetical protein 57.0 4e-08 pfa:PFL0450c conserved Plasmodium protein 51.6 2e-06 hsa:84305 WIBG, MGC13064, PYM; within bgcn homolog (Drosophila... 41.2 0.002 mmu:78428 Wibg, A030010B05Rik, Pym; within bgcn homolog (Droso... 41.2 0.002 dre:393566 MGC65891, wibg, zgc:77281; zgc:65891; K14294 partne... 40.8 0.003 bbo:BBOV_III001080 17.m07122; hypothetical protein 40.4 0.003 cel:T20G5.9 hypothetical protein; K14294 partner of Y14 and mago 38.9 0.012 xla:494688 wibg; within bgcn homolog; K14294 partner of Y14 an... 37.4 0.037 cel:ZK617.1 unc-22; UNCoordinated family member (unc-22) 33.9 0.37 > tgo:TGME49_111750 hypothetical protein ; K14294 partner of Y14 and mago Length=250 Score = 87.8 bits (216), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/110 (40%), Positives = 67/110 (60%), Gaps = 2/110 (1%) Query 80 DSSSSSGPVVTEQTAGGQTYLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSY 139 DS S V E+T G+ YL ++TTG ++IP SRRPDGT R+ I+VR GY PLEE +++ Sbjct 25 DSRSDGSLRVEERTDMGERYLVDMTTGEKIIPGSRRPDGTYRKEIRVRAGYVPLEERRTF 84 Query 140 KTRHQLSQEQHRATTGAAIPGLTAAACCEQLTNLSISNKEANASRDPAKR 189 +TR QLS+ + + IPG + +A + I++ N R PA++ Sbjct 85 QTRQQLSRNERQVPGAGNIPGFSPSAFPPGYSG--IASPSGNGKRAPARK 132 > ath:AT1G11400 PYM; PYM (Partner of Y14-Mago); protein binding; K14294 partner of Y14 and mago Length=204 Score = 60.5 bits (145), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 37/48 (77%), Gaps = 0/48 (0%) Query 102 NLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRHQLSQEQ 149 NL G R++ +RRPDGTLR+PI++RPGYTP +E+ Y+++ L +++ Sbjct 18 NLKEGERILEPTRRPDGTLRKPIRIRPGYTPEDEVVKYQSKGSLMKKE 65 > tpv:TP03_0719 hypothetical protein Length=393 Score = 57.0 bits (136), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 0/67 (0%) Query 87 PVVTEQTAGGQTYLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRHQLS 146 P E+ G++Y T+ +TG + I S+RPDGT R+ IK+RPGY P EE + Y H+ + Sbjct 17 PTKVEKGRFGESYFTDESTGGKYIIPSKRPDGTYRKEIKIRPGYVPPEERQLYVPLHRRT 76 Query 147 QEQHRAT 153 Q T Sbjct 77 QTNQDCT 83 > pfa:PFL0450c conserved Plasmodium protein Length=167 Score = 51.6 bits (122), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 0/73 (0%) Query 93 TAGGQTYLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRHQLSQEQHRA 152 T G Y+ N T + I ++R DGT R+ I+V+ Y P EE +Y+ + +L +EQ+R Sbjct 35 TPLGDVYIINEKTQEKFIKGTQRSDGTFRKNIRVKTDYMPQEENCAYQVKGKLLEEQNRL 94 Query 153 TTGAAIPGLTAAA 165 T P + Sbjct 95 LTKNTSPNVNINV 107 > hsa:84305 WIBG, MGC13064, PYM; within bgcn homolog (Drosophila); K14294 partner of Y14 and mago Length=203 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Query 99 YLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRH 143 Y+T+ TG + I +++RPDGT R+ +V+ GY P EE+ Y+ ++ Sbjct 5 YVTD-ETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKY 48 > mmu:78428 Wibg, A030010B05Rik, Pym; within bgcn homolog (Drosophila); K14294 partner of Y14 and mago Length=202 Score = 41.2 bits (95), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Query 99 YLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRH 143 Y+T+ TG + I +++RPDGT R+ +V+ GY P EE+ Y+ ++ Sbjct 5 YVTD-ETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKY 48 > dre:393566 MGC65891, wibg, zgc:77281; zgc:65891; K14294 partner of Y14 and mago Length=194 Score = 40.8 bits (94), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Query 99 YLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRH 143 Y+T+ + + I A++RPDG+ R+P +VR GY P EE+ Y+ + Sbjct 5 YVTDESGKY--IAATQRPDGSWRKPRRVRDGYVPQEEVPVYENKF 47 > bbo:BBOV_III001080 17.m07122; hypothetical protein Length=75 Score = 40.4 bits (93), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 90 TEQTAGGQTYLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTP 132 T ++ G+TY + I SRR DG+ RR I+VRPGY P Sbjct 20 TYSSSFGETYTVGDSGKDVFIKGSRRKDGSFRRDIRVRPGYIP 62 > cel:T20G5.9 hypothetical protein; K14294 partner of Y14 and mago Length=164 Score = 38.9 bits (89), Expect = 0.012, Method: Compositional matrix adjust. Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Query 82 SSSSGPVVTEQTAGGQTYLTNLTTGHRLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKT 141 S S G + +T G+T++T A++R DGT R+ +V+ GY P +E Y+ Sbjct 13 SCSEGGDLRVETENGETFIT----------ATQRADGTWRKARRVKGGYIPQDEQPKYQN 62 Query 142 RHQLSQEQHRATTGAAI 158 + QL R++ A + Sbjct 63 KMQLEATNGRSSVPAGV 79 > xla:494688 wibg; within bgcn homolog; K14294 partner of Y14 and mago Length=199 Score = 37.4 bits (85), Expect = 0.037, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 0/36 (0%) Query 108 RLIPASRRPDGTLRRPIKVRPGYTPLEEMKSYKTRH 143 + I +++RPDG+ R+ KV+ GY P EE+ Y+ ++ Sbjct 12 KYIASTQRPDGSWRKQRKVKEGYVPQEEVPVYENKY 47 > cel:ZK617.1 unc-22; UNCoordinated family member (unc-22) Length=6839 Score = 33.9 bits (76), Expect = 0.37, Method: Composition-based stats. Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 6/98 (6%) Query 18 QQRSEQQQQQRQQQQQQRSNPRRASHRLRRRSLAAARSPSPRSSSSIFFMAGRGFGEAVE 77 + R + + + ++++Q+ ++ R+ RRS + ++SP+P++ S +GR VE Sbjct 478 KHRKDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVE 537 Query 78 VGDSSSSSGPVVTEQTAGGQTYLTNLTTGHRLIPASRR 115 SSS P E++ + + LT IP RR Sbjct 538 -HKRSSSVRPDPDEESQLDEIPSSGLT-----IPEERR 569 Lambda K H 0.311 0.123 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 5737858124 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40