bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_2040_orf1 Length=151 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_057150 NOT2 / NOT3 / NOT5 family domain-containing ... 125 4e-29 ath:AT1G07705 transcription regulator; K12605 CCR4-NOT transcr... 82.0 7e-16 ath:AT5G59710 VIP2; VIP2 (VIRE2 INTERACTING PROTEIN2); protein... 79.7 3e-15 pfa:PF11_0297 NOT family protein, putative; K12605 CCR4-NOT tr... 77.8 1e-14 cpv:cgd6_2480 CCR4-NOT transcription complex, subunit 2; NOT2.... 69.3 4e-12 tpv:TP04_0397 hypothetical protein 58.9 6e-09 cel:B0286.4 ntl-2; NOT-Like (yeast CCR4/NOT complex component)... 52.0 7e-07 dre:100037372 cnot2; zgc:162316; K12605 CCR4-NOT transcription... 49.7 4e-06 mmu:72068 Cnot2, 2600016M12Rik, 2810470K03Rik, AA537049, AA959... 48.9 6e-06 hsa:4848 CNOT2, CDC36, FLJ26456, NOT2, NOT2H; CCR4-NOT transcr... 48.9 7e-06 tpv:TP03_0069 hypothetical protein 47.8 1e-05 cpv:cgd7_2790 regena domain protein (CCR-Not complex protein s... 41.2 0.001 tgo:TGME49_033020 NOT2/NOT3/NOT5 domain-containing protein (EC... 40.4 0.002 sce:YDL165W CDC36, DNA19, NOT2; Cdc36p; K12605 CCR4-NOT transc... 39.3 0.005 xla:446827 MGC80612 protein; K12580 CCR4-NOT transcription com... 38.5 0.009 mmu:232791 Cnot3, A930039N10Rik, MGC40675; CCR4-NOT transcript... 38.1 0.011 hsa:4849 CNOT3, KIAA0691, LENG2, NOT3, NOT3H; CCR4-NOT transcr... 38.1 0.011 ath:AT5G18230 transcription regulator NOT2/NOT3/NOT5 family pr... 37.4 0.019 dre:449540 cnot3a, cnot3, fb73b06, fc17h07, wu:fb73b06, wu:fc1... 37.0 0.024 cel:Y56A3A.1 ntl-3; NOT-Like (yeast CCR4/NOT complex component... 29.6 4.0 > tgo:TGME49_057150 NOT2 / NOT3 / NOT5 family domain-containing protein ; K12605 CCR4-NOT transcription complex subunit 2 Length=499 Score = 125 bits (315), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 64/145 (44%), Positives = 80/145 (55%), Gaps = 5/145 (3%) Query 2 TLNSTECLYGAFTSPISETPVTKTVEELLPQCYVAAAPTPFRTSHLEKLETRTLFYIFYT 61 LNS +CL+ +F SP S+ P + E LLP CY+ P F+ SHLEK TLFYIFY Sbjct 156 NLNSPDCLFSSFGSPWSDAPAARDAESLLPSCYLPPVPPTFKLSHLEKFNEHTLFYIFYC 215 Query 62 SPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAP----GVSSLRKRLPEGGDPLQQQQQ 117 PRLLLQG AA EL R W YHKEW+KWF AEAP G SS + G P ++ Sbjct 216 CPRLLLQGCAAAELYNRSWQYHKEWKKWF-LAEAPSRATGRSSAGAEEGKEGSPSSERAW 274 Query 118 QQQQDQQQQQGYKEAELNQELQQQQ 142 + D +G +E ++Q Sbjct 275 GRDSDSASNRGGAGKGAEKETGKRQ 299 > ath:AT1G07705 transcription regulator; K12605 CCR4-NOT transcription complex subunit 2 Length=614 Score = 82.0 bits (201), Expect = 7e-16, Method: Composition-based stats. Identities = 43/88 (48%), Positives = 48/88 (54%), Gaps = 0/88 (0%) Query 3 LNSTECLYGAFTSPISETPVTKTVEELLPQCYVAAAPTPFRTSHLEKLETRTLFYIFYTS 62 LNSTE L+ F SP S P E +PQCY A P P KL TLFY+FY+ Sbjct 474 LNSTENLHKTFGSPWSNEPSKVDPEFSVPQCYYAKNPPPLHQGLFAKLLVETLFYVFYSM 533 Query 63 PRLLLQGYAAVELTRRQWTYHKEWRKWF 90 P+ Q YAA EL R W YHKE R WF Sbjct 534 PKDEAQLYAANELYNRGWFYHKEHRLWF 561 > ath:AT5G59710 VIP2; VIP2 (VIRE2 INTERACTING PROTEIN2); protein binding / transcription regulator Length=614 Score = 79.7 bits (195), Expect = 3e-15, Method: Composition-based stats. Identities = 41/98 (41%), Positives = 49/98 (50%), Gaps = 0/98 (0%) Query 3 LNSTECLYGAFTSPISETPVTKTVEELLPQCYVAAAPTPFRTSHLEKLETRTLFYIFYTS 62 LNST LY F SP + P VE +P CY A P P + ++ LFY FY+ Sbjct 477 LNSTGNLYKTFASPWTNEPAKSEVEFTVPNCYYATEPPPLTRASFKRFSYELLFYTFYSM 536 Query 63 PRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGVSS 100 P+ Q YAA EL R W YHKE R WF P V + Sbjct 537 PKDEAQLYAADELYERGWFYHKELRVWFFRVGEPLVRA 574 > pfa:PF11_0297 NOT family protein, putative; K12605 CCR4-NOT transcription complex subunit 2 Length=559 Score = 77.8 bits (190), Expect = 1e-14, Method: Composition-based stats. Identities = 44/103 (42%), Positives = 57/103 (55%), Gaps = 5/103 (4%) Query 3 LNSTECLYGAFTSPISETPVTKTVEELLPQCYVAAAPTPF--RTSHLEKLETRTLFYIFY 60 LNS + + +SP SE P+ + + P Y+ T F R S L KL+T TLFYIFY Sbjct 406 LNSPNYICTSVSSPFSENPIENEEDFIKPVSYLN---TKFQIRLSLLLKLQTETLFYIFY 462 Query 61 TSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGVSSLRK 103 PR +LQ YAA EL R+W YH ++KWF A +L K Sbjct 463 NLPRDVLQAYAASELYIRKWIYHIIYKKWFTPNNATSTINLEK 505 > cpv:cgd6_2480 CCR4-NOT transcription complex, subunit 2; NOT2. C terminal Not2/Not3 domains ; K12605 CCR4-NOT transcription complex subunit 2 Length=342 Score = 69.3 bits (168), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 40/101 (39%), Positives = 57/101 (56%), Gaps = 17/101 (16%) Query 2 TLNSTECLYGAFTSPISET----PVTKTVEELLPQCYVAAAPTP--------FRTSHLEK 49 LNS+ECLY F SP S + P ++T E + A A TP ++++++K Sbjct 113 NLNSSECLYLNFDSPWSSSKPAQPESETNEIIQ-----AFANTPNNVSQIIGLKSTYVQK 167 Query 50 LETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWF 90 TLFYIFY P+ LLQG+AAVEL R W Y+ + +W+ Sbjct 168 FALETLFYIFYNMPQDLLQGFAAVELCNRGWLYYPDSLQWY 208 > tpv:TP04_0397 hypothetical protein Length=272 Score = 58.9 bits (141), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%) Query 42 FRTSHLEKLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFR 91 FRT ++ KL TLFY+FY PR +Q A++EL +R W YH+ + WF+ Sbjct 178 FRTGNVSKLSLETLFYVFYNVPRDNIQSLASIELYKRLWKYHESNKLWFK 227 > cel:B0286.4 ntl-2; NOT-Like (yeast CCR4/NOT complex component) family member (ntl-2); K12605 CCR4-NOT transcription complex subunit 2 Length=444 Score = 52.0 bits (123), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 9/96 (9%) Query 9 LYGAFTSPISETPV------TKTVEELLPQCYVAAAPTPFRTSHLEKLETRTLFYIFYTS 62 LY F P +++P+ K EE + ++ P R L K+ LFY+FY Sbjct 224 LYMNFGGPWADSPIRAHELDVKVPEEYMTHNHIRDKLPPLR---LNKVSEDVLFYLFYNC 280 Query 63 PRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGV 98 P + Q AA EL R+W +HK + W ++ GV Sbjct 281 PNEIYQVAAACELYAREWRFHKSEQVWLTRSQYGGV 316 > dre:100037372 cnot2; zgc:162316; K12605 CCR4-NOT transcription complex subunit 2 Length=520 Score = 49.7 bits (117), Expect = 4e-06, Method: Composition-based stats. Identities = 37/104 (35%), Positives = 50/104 (48%), Gaps = 5/104 (4%) Query 3 LNSTECLYGAFTSPISETPV-TKTVEELLPQCYVAAAPTPFRTS--HLEKLETRTLFYIF 59 LNS E LY F SP + P + ++ +P Y+ + + L + LFY++ Sbjct 369 LNSPENLYPKFASPWASAPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLY 428 Query 60 YTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGVSSLRK 103 Y + LLQ AAVEL R W YHKE R W APG+ K Sbjct 429 YMNGGDLLQLLAAVELFNRDWRYHKEERVWI--TRAPGMEPTLK 470 > mmu:72068 Cnot2, 2600016M12Rik, 2810470K03Rik, AA537049, AA959607, AW557563, C79650, MGC115808; CCR4-NOT transcription complex, subunit 2; K12605 CCR4-NOT transcription complex subunit 2 Length=540 Score = 48.9 bits (115), Expect = 6e-06, Method: Composition-based stats. Identities = 36/104 (34%), Positives = 51/104 (49%), Gaps = 5/104 (4%) Query 3 LNSTECLYGAFTSPISETPV-TKTVEELLPQCYVAAAPTPFRTS--HLEKLETRTLFYIF 59 LNS E LY F SP + +P + ++ +P Y+ + + L + LFY++ Sbjct 389 LNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLY 448 Query 60 YTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGVSSLRK 103 Y + +LQ AAVEL R W YHKE R W APG+ K Sbjct 449 YMNGGDVLQLLAAVELFNRDWRYHKEERVWI--TRAPGMEPTMK 490 > hsa:4848 CNOT2, CDC36, FLJ26456, NOT2, NOT2H; CCR4-NOT transcription complex, subunit 2; K12605 CCR4-NOT transcription complex subunit 2 Length=540 Score = 48.9 bits (115), Expect = 7e-06, Method: Composition-based stats. Identities = 36/104 (34%), Positives = 51/104 (49%), Gaps = 5/104 (4%) Query 3 LNSTECLYGAFTSPISETPV-TKTVEELLPQCYVAAAPTPFRTS--HLEKLETRTLFYIF 59 LNS E LY F SP + +P + ++ +P Y+ + + L + LFY++ Sbjct 389 LNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLY 448 Query 60 YTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGVSSLRK 103 Y + +LQ AAVEL R W YHKE R W APG+ K Sbjct 449 YMNGGDVLQLLAAVELFNRDWRYHKEERVWI--TRAPGMEPTMK 490 > tpv:TP03_0069 hypothetical protein Length=150 Score = 47.8 bits (112), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 0/48 (0%) Query 49 KLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAP 96 +L TLF+IFY P + Q AA EL R W +HK++ WF+ AEAP Sbjct 79 RLREDTLFFIFYYLPNTIQQKLAAKELRRLSWRFHKKYLAWFQRAEAP 126 > cpv:cgd7_2790 regena domain protein (CCR-Not complex protein subunit 3) Length=394 Score = 41.2 bits (95), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 0/48 (0%) Query 43 RTSHLEKLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWF 90 TS +KL TLF+IFY Q + EL R++W +HK+ WF Sbjct 248 NTSFFDKLALDTLFFIFYFQQGTFQQFLSIQELKRKKWQFHKKCFAWF 295 > tgo:TGME49_033020 NOT2/NOT3/NOT5 domain-containing protein (EC:3.4.21.53); K12580 CCR4-NOT transcription complex subunit 3 Length=778 Score = 40.4 bits (93), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 9/89 (10%) Query 21 PVTKTVEELLPQCYVAAAPTPFRTSHLEKLETR---------TLFYIFYTSPRLLLQGYA 71 P + + L PQ AP F + L ++R TLF++FY Q A Sbjct 652 PGARPLAPLSPQIAWTCAPESFPDAPLVGYDSRQLFAGLDLDTLFFVFYYQQGTYQQYLA 711 Query 72 AVELTRRQWTYHKEWRKWFRAAEAPGVSS 100 A EL ++ W YHK++ WF+ E P +++ Sbjct 712 ARELKQQSWRYHKKYLTWFQRHEEPRITA 740 > sce:YDL165W CDC36, DNA19, NOT2; Cdc36p; K12605 CCR4-NOT transcription complex subunit 2 Length=191 Score = 39.3 bits (90), Expect = 0.005, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 54 TLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKW 89 TLF++FY P ++Q +EL +R W YHK + W Sbjct 111 TLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAW 146 > xla:446827 MGC80612 protein; K12580 CCR4-NOT transcription complex subunit 3 Length=728 Score = 38.5 bits (88), Expect = 0.009, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 48 EKLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAP 96 ++L T TLF+IFY Q AA L ++ W +H ++ WF+ E P Sbjct 639 QRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEP 687 > mmu:232791 Cnot3, A930039N10Rik, MGC40675; CCR4-NOT transcription complex, subunit 3; K12580 CCR4-NOT transcription complex subunit 3 Length=751 Score = 38.1 bits (87), Expect = 0.011, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 48 EKLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAP 96 ++L T TLF+IFY Q AA L ++ W +H ++ WF+ E P Sbjct 662 QRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEP 710 > hsa:4849 CNOT3, KIAA0691, LENG2, NOT3, NOT3H; CCR4-NOT transcription complex, subunit 3; K12580 CCR4-NOT transcription complex subunit 3 Length=753 Score = 38.1 bits (87), Expect = 0.011, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 48 EKLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAP 96 ++L T TLF+IFY Q AA L ++ W +H ++ WF+ E P Sbjct 664 QRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEP 712 > ath:AT5G18230 transcription regulator NOT2/NOT3/NOT5 family protein; K12580 CCR4-NOT transcription complex subunit 3 Length=845 Score = 37.4 bits (85), Expect = 0.019, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 0/49 (0%) Query 52 TRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAPGVSS 100 T TLF+ FY Q AA EL ++ W YH+++ WF+ + P +++ Sbjct 751 TDTLFFAFYYQQNSYQQYLAAKELKKQSWRYHRKFNTWFQRHKEPKIAT 799 > dre:449540 cnot3a, cnot3, fb73b06, fc17h07, wu:fb73b06, wu:fc17h07, zgc:92813; CCR4-NOT transcription complex, subunit 3a; K12580 CCR4-NOT transcription complex subunit 3 Length=632 Score = 37.0 bits (84), Expect = 0.024, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 48 EKLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEWRKWFRAAEAP 96 ++L T TLF+IFY Q +A L ++ W +H ++ WF+ E P Sbjct 543 QRLSTETLFFIFYYLEGTKAQYLSAKALKKQSWRFHTKYMMWFQRHEEP 591 > cel:Y56A3A.1 ntl-3; NOT-Like (yeast CCR4/NOT complex component) family member (ntl-3); K12580 CCR4-NOT transcription complex subunit 3 Length=701 Score = 29.6 bits (65), Expect = 4.0, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Query 30 LPQCYVAAAPTPFRTSHLE---KLETRTLFYIFYTSPRLLLQGYAAVELTRRQWTYHKEW 86 +P Y AP + LE +L TLF+IFY Q AA L + W +H ++ Sbjct 593 VPSWYGQTAPN--TSDSLEYYLRLAPDTLFFIFYYMEGTRAQLLAAKALKKLSWRFHTKY 650 Query 87 RKWFRAAEAP 96 WF+ E P Sbjct 651 LTWFQRHEEP 660 Lambda K H 0.315 0.128 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3199347004 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40