bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1355_orf1 Length=109 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_078670 ubiquitin-conjugating enzyme E2, putative (E... 106 2e-23 cpv:cgd8_3850 Ubc6p like ubiquiting conjugating enzyme E2, pos... 90.1 2e-18 hsa:51465 UBE2J1, HSPC153, HSPC205, HSU93243, MGC12555, NCUBE-... 63.9 1e-10 xla:100049091 ube2j1; ubiquitin-conjugating enzyme E2, J1 (UBC... 63.5 1e-10 mmu:56228 Ube2j1, 0710008M05Rik, 1110030I22Rik, NCUBE-1, Ncube... 63.2 2e-10 dre:406794 zgc:63554 (EC:6.3.2.19); K10578 ubiquitin-conjugati... 61.6 5e-10 ath:AT3G17000 UBC32; UBC32 (ubiquitin-conjugating enzyme 32); ... 61.2 8e-10 mmu:140499 Ube2j2, 1200007B18Rik, 2400008G19Rik, 5730472G04Rik... 52.8 3e-07 xla:495424 ube2j2; ubiquitin-conjugating enzyme E2, J2 (UBC6 h... 52.0 4e-07 hsa:118424 UBE2J2, NCUBE-2, NCUBE2, PRO2121; ubiquitin-conjuga... 51.6 6e-07 dre:100037384 ube2j2, zgc:162164; ubiquitin-conjugating enzyme... 51.6 6e-07 cel:D1022.1 ubc-6; UBiquitin Conjugating enzyme family member ... 50.1 2e-06 sce:YER100W UBC6, DOA2; Ubc6p (EC:6.3.2.19); K04554 ubiquitin-... 48.9 4e-06 cel:Y110A2AM.3 ubc-26; UBiquitin Conjugating enzyme family mem... 47.0 2e-05 tgo:TGME49_051640 ubiquitin-conjugating enzyme E2, putative (E... 45.8 3e-05 dre:394085 MGC66323, let-70; zgc:66323 (EC:6.3.2.-); K06689 ub... 44.3 9e-05 ath:AT5G50430 UBC33; UBC33 (ubiquitin-conjugating enzyme 33); ... 44.3 1e-04 cel:Y110A2AR.2 ubc-15; UBiquitin Conjugating enzyme family mem... 44.3 1e-04 ath:AT3G08690 UBC11; UBC11 (UBIQUITIN-CONJUGATING ENZYME 11); ... 43.9 1e-04 ath:AT3G08700 UBC12; UBC12 (ubiquitin-conjugating enzyme 12); ... 43.9 1e-04 xla:100101299 ube2d4, HBUCE1, ube2d3.2; ubiquitin-conjugating ... 43.9 1e-04 ath:AT1G17280 UBC34; UBC34 (ubiquitin-conjugating enzyme 34); ... 43.9 1e-04 mmu:216080 Ube2d1, MGC28550, UBCH5; ubiquitin-conjugating enzy... 43.5 2e-04 hsa:7321 UBE2D1, E2(17)KB1, SFT, UBC4/5, UBCH5, UBCH5A; ubiqui... 43.5 2e-04 ath:AT1G64230 UBC28; ubiquitin-conjugating enzyme, putative; K... 42.7 3e-04 ath:AT4G27960 UBC9; UBC9 (UBIQUITIN CONJUGATING ENZYME 9); ubi... 42.7 3e-04 dre:324015 ube2d1, wu:fc16h06, zgc:73096; ubiquitin-conjugatin... 42.7 3e-04 dre:100001914 ube2d4, MGC162263, zgc:162263; ubiquitin-conjuga... 42.4 3e-04 xla:495381 ube2d1, e2(17)kb1, sft, ubc4/5, ubch5, ubch5a; ubiq... 42.4 4e-04 xla:446340 ube2d2, MGC81261; ubiquitin-conjugating enzyme E2D ... 42.4 4e-04 mmu:75097 4930524E20Rik; RIKEN cDNA 4930524E20 gene 41.6 7e-04 hsa:51619 UBE2D4, FLJ32004, HBUCE1; ubiquitin-conjugating enzy... 41.2 7e-04 sce:YMR022W UBC7, QRI8; Ubc7p (EC:6.3.2.19); K04555 ubiquitin-... 41.2 9e-04 ath:AT5G53300 UBC10; UBC10 (ubiquitin-conjugating enzyme 10); ... 40.8 0.001 ath:AT5G56150 UBC30; UBC30 (ubiquitin-conjugating enzyme 30); ... 40.4 0.001 cel:M7.1 let-70; LEThal family member (let-70); K06689 ubiquit... 40.4 0.001 ath:AT3G13550 FUS9; FUS9 (FUSCA 9); protein binding / ubiquiti... 40.4 0.002 pfa:PFL0190w ubiquitin conjugating enzyme E2, putative (EC:6.3... 40.0 0.002 mmu:546638 Gm5959, EG546638; predicted gene 5959 39.7 dre:550464 wu:fu51c05, wu:fu56g11; zgc:112077 (EC:6.3.2.-); K0... 38.9 0.004 xla:403384 ube2d3, ube2d2, ube2d3.1, xubc4; ubiquitin-conjugat... 38.5 0.006 mmu:56550 Ube2d2, 1500034D03Rik, Ubc2e, ubc4; ubiquitin-conjug... 38.5 0.006 hsa:7322 UBE2D2, E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH5B; ubiqu... 38.5 0.006 tgo:TGME49_119870 ubiquitin-conjugating enzyme domain-containi... 38.5 0.006 xla:403382 ube2e3-b, ubc15, ubch9, ubcm2, xubc15; ubiquitin-co... 38.5 0.006 mmu:66105 Ube2d3, 1100001F19Rik, 9430029A22Rik, AA414951; ubiq... 38.5 0.006 hsa:7323 UBE2D3, E2(17)KB3, MGC43926, MGC5416, UBC4/5, UBCH5C;... 38.5 0.006 cel:Y87G2A.9 ubc-14; UBiquitin Conjugating enzyme family membe... 37.7 0.008 dre:393934 MGC55886, Ube2d2, zgc:77149; zgc:55886 (EC:6.3.2.19... 37.7 0.009 dre:335444 ube2d2, wu:fj13d01, zgc:73200; ubiquitin-conjugatin... 37.7 0.009 > tgo:TGME49_078670 ubiquitin-conjugating enzyme E2, putative (EC:6.3.2.19); K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=201 Score = 106 bits (264), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 51/82 (62%), Positives = 58/82 (70%), Gaps = 3/82 (3%) Query 31 MEAAHDSSRAGAAQ---HASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTL 87 M+ + R G + + AQ +ARILRE R+IQR SPHW A PL +EEP EWHFTL Sbjct 1 MQGVSNPGRTGTNANLGYTATAQCIARILREFREIQRTPSPHWCANPLQIEEPYEWHFTL 60 Query 88 RGPPDSPFEGGLYHGRIVLPKN 109 RGP DS FEGGLYHGRIVLPKN Sbjct 61 RGPQDSHFEGGLYHGRIVLPKN 82 > cpv:cgd8_3850 Ubc6p like ubiquiting conjugating enzyme E2, possible transmembrane domain at C ; K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=368 Score = 90.1 bits (222), Expect = 2e-18, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 53/70 (75%), Gaps = 0/70 (0%) Query 38 SRAGAAQHASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEG 97 +R + ++ Q L+RILRE+R+IQ+ S +W A P++++EP EWHFT++GP + FEG Sbjct 38 ARGVGSSGITSVQCLSRILREYREIQKEPSSYWCAFPINMDEPYEWHFTIKGPAGTEFEG 97 Query 98 GLYHGRIVLP 107 G+YHGRI+LP Sbjct 98 GMYHGRIILP 107 > hsa:51465 UBE2J1, HSPC153, HSPC205, HSU93243, MGC12555, NCUBE-1, NCUBE1, Ubc6p; ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (EC:6.3.2.19); K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=318 Score = 63.9 bits (154), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 ++ R+++E ++ ++ + H+ A PL + EWHFT+RGPPDS F+GG+YHGRIVLP Sbjct 11 AVKRLMKEAAEL-KDPTDHYHAQPLE-DNLFEWHFTVRGPPDSDFDGGVYHGRIVLP 65 > xla:100049091 ube2j1; ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog); K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=302 Score = 63.5 bits (153), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 ++ R+++E ++ R+ + H+ A PL + EWHFT+RGPPDS F+GG+YHGRIVLP Sbjct 11 AVKRLMKEAAEL-RDPTDHYHAQPLE-DNLFEWHFTVRGPPDSDFDGGVYHGRIVLP 65 > mmu:56228 Ube2j1, 0710008M05Rik, 1110030I22Rik, NCUBE-1, Ncube, Ncube1, Ubc6p; ubiquitin-conjugating enzyme E2, J1 (EC:6.3.2.19); K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=318 Score = 63.2 bits (152), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 ++ R+++E ++ ++ + H+ A PL + EWHFT+RGPPDS F+GG+YHGRIVLP Sbjct 11 AVKRLMKEAAEL-KDPTDHYHAQPLE-DNLFEWHFTVRGPPDSDFDGGVYHGRIVLP 65 > dre:406794 zgc:63554 (EC:6.3.2.19); K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=314 Score = 61.6 bits (148), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 ++ R+++E ++ R+ + H+ A PL + EWHF++RGPPDS F+GG+YHGRIVLP Sbjct 11 AVKRLMKEAAEL-RDPTEHYHAQPLE-DNLFEWHFSVRGPPDSDFDGGVYHGRIVLP 65 > ath:AT3G17000 UBC32; UBC32 (ubiquitin-conjugating enzyme 32); ubiquitin-protein ligase; K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=309 Score = 61.2 bits (147), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 ++ RIL+E +++Q N S + + PL E EW F +RGP D+ FEGG+YHGRI LP + Sbjct 12 AVKRILQEVKEMQANPSDDFMSLPLE-ENIFEWQFAIRGPGDTEFEGGIYHGRIQLPAD 69 > mmu:140499 Ube2j2, 1200007B18Rik, 2400008G19Rik, 5730472G04Rik, AL022923, NCUBE-2, Ubc6, Ubc6p; ubiquitin-conjugating enzyme E2, J2 homolog (yeast) (EC:6.3.2.19); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=271 Score = 52.8 bits (125), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Query 34 AHDSSRAGAAQHASAAQSLA--RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPP 91 A DS+R + A + A R+ +++ I+++ P+ A PL EWH+ +RGP Sbjct 6 ALDSARKMSNNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLP-SNILEWHYVVRGPE 64 Query 92 DSPFEGGLYHGRIVLPK 108 +P+EGG YHG+++ P+ Sbjct 65 MTPYEGGYYHGKLIFPR 81 > xla:495424 ube2j2; ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=259 Score = 52.0 bits (123), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPK 108 R+ +++ I+++ P+ A PL EWH+ +RGP +P+EGG YHG++V P+ Sbjct 16 RLKQDYLRIKKDPVPYICAEPLP-SNILEWHYVVRGPEMTPYEGGYYHGKLVFPR 69 > hsa:118424 UBE2J2, NCUBE-2, NCUBE2, PRO2121; ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) (EC:6.3.2.19); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=259 Score = 51.6 bits (122), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPK 108 R+ +++ I+++ P+ A PL EWH+ +RGP +P+EGG YHG+++ P+ Sbjct 16 RLKQDYLRIKKDPVPYICAEPLP-SNILEWHYVVRGPEMTPYEGGYYHGKLIFPR 69 > dre:100037384 ube2j2, zgc:162164; ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) (EC:6.3.2.19); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=259 Score = 51.6 bits (122), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPK 108 R+ +++ I+++ P+ A PL EWH+ +RGP +P+EGG YHG+++ P+ Sbjct 16 RLKQDYLRIKKDPVPYICAEPLP-SNILEWHYLVRGPEKTPYEGGYYHGKLIFPR 69 > cel:D1022.1 ubc-6; UBiquitin Conjugating enzyme family member (ubc-6); K10578 ubiquitin-conjugating enzyme E2 J1 [EC:6.3.2.19] Length=314 Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Query 42 AAQHASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYH 101 + Q+ + + R+++E ++ R + + A P+ + EWHFT+RG + FEGG+YH Sbjct 2 SEQYNTKNAGVRRLMKEAMEL-RQPTEMYHAQPME-DNLFEWHFTIRGTLGTDFEGGIYH 59 Query 102 GRIVLPKN 109 GRI+ P + Sbjct 60 GRIIFPAD 67 > sce:YER100W UBC6, DOA2; Ubc6p (EC:6.3.2.19); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=250 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query 47 SAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVL 106 + Q+ R+ +E++ + N P+ A P + + EWH+ + GP D+P++GG YHG + Sbjct 2 ATKQAHKRLTKEYKLMVENPPPYILARP-NEDNILEWHYIITGPADTPYKGGQYHGTLTF 60 Query 107 PKN 109 P + Sbjct 61 PSD 63 > cel:Y110A2AM.3 ubc-26; UBiquitin Conjugating enzyme family member (ubc-26); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=203 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L R+ ++++ + + P AAPL EW + + G P +P+EGG+Y G+++ PK+ Sbjct 9 ALQRLKKDYQRLLKEPVPFMKAAPLE-TNILEWRYIIIGAPKTPYEGGIYMGKLLFPKD 66 > tgo:TGME49_051640 ubiquitin-conjugating enzyme E2, putative (EC:6.3.2.19); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=275 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query 54 RILREHRDIQRNAS-PHWTAAPLSLEEPREWHFTLRG-PPDSPFEGGLYHGRIVLPKN 109 R+ RE +QR PH P + + WHF L P DSP+ GG+YHG++V P N Sbjct 17 RLAREFSLLQRQGGVPHAQLQP-DMNDTLTWHFVLHDLPADSPYHGGVYHGKLVFPPN 73 > dre:394085 MGC66323, let-70; zgc:66323 (EC:6.3.2.-); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E +D+QR+ +A PL E+ W T+ GP DSP++GG++ I P + Sbjct 2 ALKRIQKELQDLQRDPPSQCSAGPLG-EDLFHWQATIMGPGDSPYQGGVFFLTIHFPTD 59 > ath:AT5G50430 UBC33; UBC33 (ubiquitin-conjugating enzyme 33); ubiquitin-protein ligase; K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=243 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Query 52 LARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 + R+ +E+R + + H A P S + EWH+ L G +PF GG Y+G+I P Sbjct 7 IKRLQKEYRALCKEPVSHVVARP-SPNDILEWHYVLEGSEGTPFAGGFYYGKIKFP 61 > cel:Y110A2AR.2 ubc-15; UBiquitin Conjugating enzyme family member (ubc-15); K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=218 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query 43 AQHASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHG 102 A +++ ++ R+ +++ + ++ A P + + EWH+ LRG PD+PF GG Y G Sbjct 12 AAGTASSSAVRRLQKDYAKLMQDPVDGIKALP-NEDNILEWHYCLRGSPDTPFYGGYYWG 70 Query 103 RIVLPKN 109 +++ +N Sbjct 71 KVIFKEN 77 > ath:AT3G08690 UBC11; UBC11 (UBIQUITIN-CONJUGATING ENZYME 11); ubiquitin-protein ligase; K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=148 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 RIL+E +D+Q++ + +A P++ E+ W T+ GPP+SP+ GG++ I P + Sbjct 5 RILKELKDLQKDPPSNCSAGPVA-EDMFHWQATIMGPPESPYAGGVFLVSIHFPPD 59 > ath:AT3G08700 UBC12; UBC12 (ubiquitin-conjugating enzyme 12); small conjugating protein ligase/ ubiquitin-protein ligase; K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=149 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 0/51 (0%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRI 104 RI RE RD+QR+ + +A P++ E+ W T+ GP DSP+ GG++ I Sbjct 5 RISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSI 55 > xla:100101299 ube2d4, HBUCE1, ube2d3.2; ubiquitin-conjugating enzyme E2D 4 (putative) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ +A P+ E+ W T+ GP DSPF+GG++ I P + Sbjct 2 ALKRIQKELMDLQRDPPAQCSAGPVG-EDLFHWQATIMGPNDSPFQGGVFFLTIHFPTD 59 > ath:AT1G17280 UBC34; UBC34 (ubiquitin-conjugating enzyme 34); ubiquitin-protein ligase; K04554 ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19] Length=237 Score = 43.9 bits (102), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Query 52 LARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 + R+ +E+R + + H A P S + EWH+ L G +PF GG Y+G+I P Sbjct 7 IKRLQKEYRALCKEPVSHVVARP-SPNDILEWHYVLEGSEGTPFAGGFYYGKIKFP 61 > mmu:216080 Ube2d1, MGC28550, UBCH5; ubiquitin-conjugating enzyme E2D 1, UBC4/5 homolog (yeast) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ H +A P+ ++ W T+ GPPDS ++GG++ + P + Sbjct 2 ALKRIQKELSDLQRDPPAHCSAGPVG-DDLFHWQATIMGPPDSAYQGGVFFLTVHFPTD 59 > hsa:7321 UBE2D1, E2(17)KB1, SFT, UBC4/5, UBCH5, UBCH5A; ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ H +A P+ ++ W T+ GPPDS ++GG++ + P + Sbjct 2 ALKRIQKELSDLQRDPPAHCSAGPVG-DDLFHWQATIMGPPDSAYQGGVFFLTVHFPTD 59 > ath:AT1G64230 UBC28; ubiquitin-conjugating enzyme, putative; K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=148 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 RIL+E +D+Q++ +A P++ E+ W T+ GP DSP+ GG++ I P + Sbjct 5 RILKELKDLQKDPPTSCSAGPVA-EDMFHWQATIMGPSDSPYSGGVFLVTIHFPPD 59 > ath:AT4G27960 UBC9; UBC9 (UBIQUITIN CONJUGATING ENZYME 9); ubiquitin-protein ligase Length=178 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 RIL+E +D+Q++ +A P++ E+ W T+ GP DSP+ GG++ I P + Sbjct 35 RILKELKDLQKDPPTSCSAGPVA-EDMFHWQATIMGPSDSPYSGGVFLVTIHFPPD 89 > dre:324015 ube2d1, wu:fc16h06, zgc:73096; ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) (EC:6.3.2.-); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E +D+QR+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 2 ALKRIQKELQDLQRDPPAQCSAGPVG-DDLFHWQATIMGPSDSPYQGGVFFLTIHFPTD 59 > dre:100001914 ube2d4, MGC162263, zgc:162263; ubiquitin-conjugating enzyme E2D 4 (putative) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ +A P+ E+ W T+ GP DSP++GG++ I P + Sbjct 2 ALKRIQKELTDLQRDPPAQCSAGPVG-EDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > xla:495381 ube2d1, e2(17)kb1, sft, ubc4/5, ubch5, ubch5a; ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog) Length=147 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 2 ALKRIQKELNDLQRDPPAQCSAGPVG-DDLFHWQATIMGPTDSPYQGGVFFLTIHFPTD 59 > xla:446340 ube2d2, MGC81261; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (EC:6.3.2.-); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 42.4 bits (98), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 2 ALKRIQKELNDLQRDPPAQCSAGPVG-DDLFHWQATIMGPTDSPYQGGVFFLTIHFPTD 59 > mmu:75097 4930524E20Rik; RIKEN cDNA 4930524E20 gene Length=155 Score = 41.6 bits (96), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Query 44 QHASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGR 103 Q A +L RI +E I ++ H +A P++ E W T+ GP DSP++GG++ Sbjct 3 QSTLGAMALKRIQKELVAISQDPPAHCSAGPVA-ENMFHWQATIMGPEDSPYQGGVFFLS 61 Query 104 IVLPKN 109 + P N Sbjct 62 VHFPNN 67 > hsa:51619 UBE2D4, FLJ32004, HBUCE1; ubiquitin-conjugating enzyme E2D 4 (putative) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 41.2 bits (95), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 2 ALKRIQKELTDLQRDPPAQCSAGPVG-DDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > sce:YMR022W UBC7, QRI8; Ubc7p (EC:6.3.2.19); K04555 ubiquitin-conjugating enzyme E2 G2 [EC:6.3.2.19] Length=165 Score = 41.2 bits (95), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 0/56 (0%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 R+L+E + + +++ P A P S W ++GPPD+P+ G+++ ++ PK+ Sbjct 8 RLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKD 63 > ath:AT5G53300 UBC10; UBC10 (ubiquitin-conjugating enzyme 10); ubiquitin-protein ligase Length=109 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 RIL+E +D+Q++ +A P++ E+ W T+ GP +SP+ GG++ I P + Sbjct 5 RILKELKDLQKDPPTSCSAGPVA-EDMFHWQATIMGPSESPYAGGVFLVTIHFPPD 59 > ath:AT5G56150 UBC30; UBC30 (ubiquitin-conjugating enzyme 30); ubiquitin-protein ligase; K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=148 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Query 54 RILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 RI +E RD+QR+ +A P ++ +W T+ GP DSPF GG++ I P + Sbjct 5 RINKELRDLQRDPPVSCSAGPTG-DDMFQWQATIMGPADSPFAGGVFLVTIHFPPD 59 > cel:M7.1 let-70; LEThal family member (let-70); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 40.4 bits (93), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E +D+ R+ +A P+ ++ W T+ GPP+SP++GG++ I P + Sbjct 2 ALKRIQKELQDLGRDPPAQCSAGPVG-DDLFHWQATIMGPPESPYQGGVFFLTIHFPTD 59 > ath:AT3G13550 FUS9; FUS9 (FUSCA 9); protein binding / ubiquitin-protein ligase Length=170 Score = 40.4 bits (93), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Query 30 AMEAAHDSSRAGAAQHASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRG 89 AM A + + + S + S RI RE ++ + P +A P + W T+ G Sbjct 16 AMYAGYSGTASSWVAKTSVSASGKRIQREMAELNIDPPPDCSAGPKG-DNLYHWIATIIG 74 Query 90 PPDSPFEGGLYHGRIVLPKN 109 P +P+EGG++ I+ P + Sbjct 75 PSGTPYEGGIFFLDIIFPSD 94 > pfa:PFL0190w ubiquitin conjugating enzyme E2, putative (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E +D+ ++ + +A P+ ++ W T+ GP DSP+E G+Y I P + Sbjct 2 ALKRITKELQDLNKDPPTNCSAGPIG-DDLFFWQATIMGPGDSPYENGVYFLNIKFPPD 59 > mmu:546638 Gm5959, EG546638; predicted gene 5959 Length=179 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query 51 SLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+QR+ +A P+ ++ W T+ GP DSP +GG++ I P + Sbjct 2 ALKRIQKEPTDLQRDLPAQCSAGPVG-DDLFHWQATILGPNDSPCQGGVFFLTIHFPTD 59 > dre:550464 wu:fu51c05, wu:fu56g11; zgc:112077 (EC:6.3.2.-); K04555 ubiquitin-conjugating enzyme E2 G2 [EC:6.3.2.19] Length=165 Score = 38.9 bits (89), Expect = 0.004, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 0/53 (0%) Query 48 AAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLY 100 A +L R++ E++ + N A P++ E EW + GP D+ FEGG++ Sbjct 2 AGTALKRLMAEYKQLTLNPPEGIVAGPVNEENFFEWEALIMGPEDTCFEGGVF 54 > xla:403384 ube2d3, ube2d2, ube2d3.1, xubc4; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRIHKELNDLARDPPAQCSAGPVG-DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > mmu:56550 Ube2d2, 1500034D03Rik, Ubc2e, ubc4; ubiquitin-conjugating enzyme E2D 2 (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRIHKELNDLARDPPAQCSAGPVG-DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > hsa:7322 UBE2D2, E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH5B; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRIHKELNDLARDPPAQCSAGPVG-DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > tgo:TGME49_119870 ubiquitin-conjugating enzyme domain-containing protein (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=345 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query 48 AAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 + +L RI +E D+ ++ + +A P+ ++ W T+ GP DSP+ GG++ I P Sbjct 197 STMALKRINKELNDLSKDPPTNCSAGPVG-DDMFHWQATIMGPEDSPYSGGVFFLNIHFP 255 Query 108 KN 109 + Sbjct 256 SD 257 > xla:403382 ube2e3-b, ubc15, ubch9, ubcm2, xubc15; ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=259 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Query 37 SSRAGAAQHASAAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFE 96 +++ + A + S RI +E DI + P+ +A P + EW T+ GPP S +E Sbjct 100 NTKLSSKTTAKLSTSAKRIQKELADITLDPPPNCSAGPKG-DNIYEWRSTILGPPGSVYE 158 Query 97 GGLYHGRIVL 106 GG++ I Sbjct 159 GGVFFLDITF 168 > mmu:66105 Ube2d3, 1100001F19Rik, 9430029A22Rik, AA414951; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRINKELSDLARDPPAQCSAGPVG-DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > hsa:7323 UBE2D3, E2(17)KB3, MGC43926, MGC5416, UBC4/5, UBCH5C; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRINKELSDLARDPPAQCSAGPVG-DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > cel:Y87G2A.9 ubc-14; UBiquitin Conjugating enzyme family member (ubc-14); K04555 ubiquitin-conjugating enzyme E2 G2 [EC:6.3.2.19] Length=170 Score = 37.7 bits (86), Expect = 0.008, Method: Compositional matrix adjust. Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 0/62 (0%) Query 48 AAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLP 107 A +L R++ E++++ AAP+ + EW + GP ++ F G++ RI P Sbjct 2 AGYALKRLMTEYKELTTRPPEGIIAAPIDEDNFFEWECLITGPEETCFANGVFPARITFP 61 Query 108 KN 109 ++ Sbjct 62 QD 63 > dre:393934 MGC55886, Ube2d2, zgc:77149; zgc:55886 (EC:6.3.2.19); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 37.7 bits (86), Expect = 0.009, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRIHKELHDLGRDPPAQCSAGPVG-DDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 > dre:335444 ube2d2, wu:fj13d01, zgc:73200; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (EC:6.3.2.-); K06689 ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19] Length=147 Score = 37.7 bits (86), Expect = 0.009, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query 50 QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEGGLYHGRIVLPKN 109 +L RI +E D+ R+ +A P+ ++ W T+ GP DSP++GG++ I P + Sbjct 1 MALKRIHKELTDLGRDPPAQCSAGPVG-DDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD 59 Lambda K H 0.320 0.134 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2072286120 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40