bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1045_orf2 Length=141 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_085230 PRP38 family domain-containing protein ; K12... 69.3 4e-12 pfa:PF14_0070 pre-mRNA splicing factor, putative; K12850 pre-m... 57.4 1e-08 bbo:BBOV_III008900 17.m07776; PRP38 family protein; K12850 pre... 49.7 3e-06 tpv:TP04_0792 hypothetical protein 42.4 5e-04 > tgo:TGME49_085230 PRP38 family domain-containing protein ; K12850 pre-mRNA-splicing factor 38B Length=614 Score = 69.3 bits (168), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 33/38 (86%), Positives = 36/38 (94%), Gaps = 0/38 (0%) Query 29 AKTQQQLLQEFRRKEQEKALATGKDYARRPTSYKSALS 66 AKTQ LL+EFRRKE+EKALATGKDYARRPTSYKS+LS Sbjct 470 AKTQHDLLKEFRRKEREKALATGKDYARRPTSYKSSLS 507 > pfa:PF14_0070 pre-mRNA splicing factor, putative; K12850 pre-mRNA-splicing factor 38B Length=690 Score = 57.4 bits (137), Expect = 1e-08, Method: Composition-based stats. Identities = 27/40 (67%), Positives = 35/40 (87%), Gaps = 0/40 (0%) Query 30 KTQQQLLQEFRRKEQEKALATGKDYARRPTSYKSALSLKM 69 KT+ +L+ F++ E +KALATGKDYARRPTSYKS+LSLK+ Sbjct 576 KTEDELISRFKKLESQKALATGKDYARRPTSYKSSLSLKV 615 > bbo:BBOV_III008900 17.m07776; PRP38 family protein; K12850 pre-mRNA-splicing factor 38B Length=483 Score = 49.7 bits (117), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/72 (34%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Query 2 PKAKRSRNRDGDKERRRSRSRSAERSAAKTQQQLLQEFRRKEQEKALATGKDYARRPTSY 61 P KR R+ D R+ S+ R ++++ L +E++R+E ++ LA GKDY +RP+S+ Sbjct 411 PGNKRHRDESIDDRDRKGTGNSSVRHG-ESREALFREYKRRESDRVLAVGKDYGKRPSSF 469 Query 62 KSALSLKMTSSR 73 ++L KM ++R Sbjct 470 NASLPSKMHTNR 481 > tpv:TP04_0792 hypothetical protein Length=211 Score = 42.4 bits (98), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 16/27 (59%), Positives = 24/27 (88%), Gaps = 0/27 (0%) Query 32 QQQLLQEFRRKEQEKALATGKDYARRP 58 ++ L++EF+R+E+EKALA GKDY +RP Sbjct 169 KEDLIREFKRREREKALAVGKDYGKRP 195 Lambda K H 0.309 0.120 0.321 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2618291680 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40