bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_1017_orf2 Length=156 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_014820 DNA repair enzyme, putative ; K12840 splicin... 78.6 7e-15 ath:AT1G30480 DRT111; DRT111; nucleic acid binding / nucleotid... 35.0 0.092 dre:393889 rbm17, MGC55840, zgc:55840; RNA binding motif prote... 32.7 0.53 dre:100331631 RNA binding motif protein 17-like 32.3 0.56 tgo:TGME49_043310 hypothetical protein 32.0 0.79 dre:564608 tmem198b, MGC112212, tmem198, zgc:112212; transmemb... 30.8 1.6 ath:AT4G21150 HAP6; HAP6 (HAPLESS 6); dolichyl-diphosphooligos... 30.8 1.7 mmu:244653 Hydin, 1700034M11Rik, 4930545D19Rik, 4932703P14, A8... 30.8 2.0 cel:F58B3.7 hypothetical protein; K12840 splicing factor 45 30.4 cel:T07C4.3 hypothetical protein 29.6 4.7 hsa:94121 SYTL4, DKFZp451P0116, FLJ40960, SLP4; synaptotagmin-... 28.9 7.3 mmu:22138 Ttn, 1100001C23Rik, 2310036G12Rik, 2310057K23Rik, 23... 28.9 7.4 hsa:50618 ITSN2, KIAA1256, PRO2015, SH3D1B, SH3P18, SWA, SWAP;... 28.5 9.2 > tgo:TGME49_014820 DNA repair enzyme, putative ; K12840 splicing factor 45 Length=466 Score = 78.6 bits (192), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 34/61 (55%), Positives = 45/61 (73%), Gaps = 0/61 (0%) Query 95 GSSSPLDPTTWVPVGLWPQEYDPSKPNDYTAIHKEKMRQQQREELERLRQQELEKQKHDE 154 G + + +V +G EYDP PNDY+AI++EK+R+QQREELERLRQQEL+KQ+ D Sbjct 196 GGDKETESSGFVSIGQMKDEYDPGTPNDYSAIYREKIRKQQREELERLRQQELDKQRRDR 255 Query 155 E 155 E Sbjct 256 E 256 > ath:AT1G30480 DRT111; DRT111; nucleic acid binding / nucleotide binding; K12840 splicing factor 45 Length=387 Score = 35.0 bits (79), Expect = 0.092, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Query 113 QEYDPSKPNDYTAIHKEKMRQQQREELERLRQQELEKQKH 152 +EYDP++PNDY +EK R+ E++R E++K++ Sbjct 100 EEYDPARPNDYEEYKREKKRKATEAEMKR----EMDKRRQ 135 > dre:393889 rbm17, MGC55840, zgc:55840; RNA binding motif protein 17; K12840 splicing factor 45 Length=418 Score = 32.7 bits (73), Expect = 0.53, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 5/33 (15%) Query 114 EYDPSKPNDYTAIHKEKMRQQQREELERLRQQE 146 EYDP PNDY EK+ ++ REE ++ R+QE Sbjct 99 EYDPMFPNDY-----EKVLKRHREERQKQREQE 126 > dre:100331631 RNA binding motif protein 17-like Length=418 Score = 32.3 bits (72), Expect = 0.56, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 5/33 (15%) Query 114 EYDPSKPNDYTAIHKEKMRQQQREELERLRQQE 146 EYDP PNDY EK+ ++ REE ++ R+QE Sbjct 99 EYDPMFPNDY-----EKVLKRHREERQKQREQE 126 > tgo:TGME49_043310 hypothetical protein Length=1266 Score = 32.0 bits (71), Expect = 0.79, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Query 124 TAIHKEKMRQ-QQREELERLRQQELEKQKHDEEA 156 TA+ E+ ++ +QREE ER+R Q LE+++ +EEA Sbjct 941 TALTAEETQELRQREEAERVRHQMLERKRKEEEA 974 > dre:564608 tmem198b, MGC112212, tmem198, zgc:112212; transmembrane protein 198b Length=369 Score = 30.8 bits (68), Expect = 1.6, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 11/64 (17%) Query 92 VTVGSSSPLDPTTWVPVGLWP---------QEYDPSKPNDYTAIHKEKMRQQQREELERL 142 V G P+ TTWV +G WP Q ++ +T + RQQ+R +L R+ Sbjct 208 VKTGPREPVCWTTWVVLGAWPALALLGVLVQWRVTAEGYSHTKVMIS--RQQRRVQLMRI 265 Query 143 RQQE 146 RQ+E Sbjct 266 RQKE 269 > ath:AT4G21150 HAP6; HAP6 (HAPLESS 6); dolichyl-diphosphooligosaccharide-protein glycotransferase; K12667 oligosaccharyltransferase complex subunit delta (ribophorin II) Length=691 Score = 30.8 bits (68), Expect = 1.7, Method: Composition-based stats. Identities = 33/110 (30%), Positives = 45/110 (40%), Gaps = 8/110 (7%) Query 9 MAKAAPKSSPSLNVQAAAADAALVLERLKKLHAGVLAEEQKPDGAASRAVASAAGSSAKA 68 + +A PK S +QA DA L+L+ + VLA+EQ P S A A S K+ Sbjct 107 IGEAGPKDIVS-QLQAGVKDAKLLLDFYYSVRGLVLAKEQFPGTHISLGDAEAIFRSIKS 165 Query 69 GDVGAGGAESGHNETEPIVNVVSVTVGSSSPLDPTTWVPVGLWPQEYDPS 118 G N E S T + + V + L P E+DPS Sbjct 166 LSQSDGRWRYSSNNPE------SSTFAAGLAYETLAGV-ISLAPSEFDPS 208 > mmu:244653 Hydin, 1700034M11Rik, 4930545D19Rik, 4932703P14, A830061H17, AC069308.21gm4, hy-3, hy3, hyrh; hydrocephalus inducing Length=5154 Score = 30.8 bits (68), Expect = 2.0, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 11/53 (20%) Query 114 EYDPSKPNDYTAIHK---EKMRQQQREELERLR--------QQELEKQKHDEE 155 EYD + A + + +R++++ ELERL QQELE+QK ++E Sbjct 2344 EYDALTAEEKVAFDRDVRQALRERKKRELERLAKEMQEKKLQQELERQKEEDE 2396 > cel:F58B3.7 hypothetical protein; K12840 splicing factor 45 Length=371 Score = 30.4 bits (67), Expect = 2.3, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query 114 EYDPSKPNDYTAIHKEKMRQQQREELERLRQQELEKQKHDEE 155 EY P PN+Y + KE ++QRE+ R + L+++ H+EE Sbjct 113 EYYPMTPNNYEVVAKEINDRKQREKTAREVAKRLQRE-HEEE 153 > cel:T07C4.3 hypothetical protein Length=649 Score = 29.6 bits (65), Expect = 4.7, Method: Compositional matrix adjust. Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Query 22 VQAAAADAALVLERLKKLHAGVLAEEQKPDGAASRAVASAAGSSAKAGDVGAGGAESGHN 81 V A A+ + ++K AGV E KP ++ + GS+ + +V + + H Sbjct 332 VSAELANGKPIKHLIEKFDAGVNFAEHKPKSIYAQVLEEIGGSAPRVDEVFSASKKEEHA 391 Query 82 ETEPIVNVVSVTVGSSSPL 100 ETE + NV+ + + S + Sbjct 392 ETE-VTNVIFRSTSTHSSI 409 > hsa:94121 SYTL4, DKFZp451P0116, FLJ40960, SLP4; synaptotagmin-like 4 Length=671 Score = 28.9 bits (63), Expect = 7.3, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 0/58 (0%) Query 15 KSSPSLNVQAAAADAALVLERLKKLHAGVLAEEQKPDGAASRAVASAAGSSAKAGDVG 72 KS P LNV + ++ L KLH LA G++ + S ++AGD G Sbjct 295 KSVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGDFG 352 > mmu:22138 Ttn, 1100001C23Rik, 2310036G12Rik, 2310057K23Rik, 2310074I15Rik, AF006999, AV006427, D330041I19Rik, D830007G01Rik, L56, mdm, shru; titin (EC:2.7.11.1); K12567 titin [EC:2.7.11.1] Length=33467 Score = 28.9 bits (63), Expect = 7.4, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 129 EKMRQQQREELERLRQQELEKQKHDEE 155 E ++Q Q EE RL +ELEK + DE+ Sbjct 8605 ELLKQSQEEETHRLEIEELEKSERDEK 8631 > hsa:50618 ITSN2, KIAA1256, PRO2015, SH3D1B, SH3P18, SWA, SWAP; intersectin 2 Length=1697 Score = 28.5 bits (62), Expect = 9.2, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 128 KEKMRQQQREELERLRQQELEKQKHDEE 155 K+++ +Q+R E ER+R+QEL QK+ E+ Sbjct 451 KQELERQRRLEWERIRRQELLNQKNREQ 478 Lambda K H 0.305 0.122 0.335 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3451799900 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40