bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_0796_orf2 Length=164 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_055260 apical membrane antigen 1, putative ; K13845... 67.8 2e-11 mmu:19027 Sypl, AI314763, AI604763, D12Ertd446e, PanI, Pphn, S... 36.6 0.037 ath:AT5G59700 protein kinase, putative 33.9 0.25 dre:560446 similar to TGF-beta type II receptor; K04388 TGF-be... 32.0 1.00 dre:100005188 hypothetical LOC100005188 31.2 1.7 mmu:21933 Tnfrsf10b, DR5, KILLER, Ly98, MK, TRAILR2, TRICK2A, ... 30.4 2.9 xla:399392 robo1, dutt1, roundabout; roundabout, axon guidance... 29.6 4.5 xla:373810 syn2-a, synII, synIIa, synIIb; synapsin II 29.6 4.8 hsa:6091 ROBO1, DUTT1, FLJ21882, MGC131599, MGC133277, SAX3; r... 29.3 5.3 mmu:14807 Grik3, 9630027E11, GluR7-3, Glur-7, Glur7; glutamate... 29.3 5.7 hsa:133482 SLCO6A1, CT48, GST, MGC26949, OATP6A1, OATPY; solut... 28.9 7.5 ath:AT5G10530 lectin protein kinase, putative 28.9 8.2 hsa:642132 roundabout homolog 1-like; K06753 roundabout, axon ... 28.5 10.0 > tgo:TGME49_055260 apical membrane antigen 1, putative ; K13845 apical merozoite antigen 1 Length=569 Score = 67.8 bits (164), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 56/183 (30%), Positives = 83/183 (45%), Gaps = 25/183 (13%) Query 1 CLLPRQGAAAFTSVGSLEEEELPHCDPT-------------------FPASLGSCDPSSC 41 CL+ A ++T+ GSL EE P+ FP S G+CD +C Sbjct 393 CLVSDSAAVSYTAAGSLSEETPNFIIPSNPSVTPPTPETALQCTADKFPDSFGACDVQAC 452 Query 42 KAILTECRGGRLVEQQTDCVPEDGSKCESKGGGVFIGLAVAGGLLLLLLTGGAFFIYKQR 101 K T C GG++ DC ++ ++C S + LL LL G F R Sbjct 453 KRQKTSCVGGQIQSTSVDCTADEQNECGSNTALIAGLAVGGVLLLALLGGGCYFAKRLDR 512 Query 102 QKALPKESSPQRTDFVQDEAATGRGKKRQSDLVQQAEPSLWEEAEADEPHADENTQVLLD 161 K + +++ +F D A KKR SDL+Q+AEPS W+EAE + D T V+++ Sbjct 513 NKGV--QAAHHEHEFQSDRGAR---KKRPSDLMQEAEPSFWDEAE-ENIEQDGETHVMVE 566 Query 162 QEY 164 +Y Sbjct 567 GDY 569 > mmu:19027 Sypl, AI314763, AI604763, D12Ertd446e, PanI, Pphn, Sypl1; synaptophysin-like protein Length=261 Score = 36.6 bits (83), Expect = 0.037, Method: Compositional matrix adjust. Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 15/109 (13%) Query 18 EEEELPHCD--PTFPASLGSCDPSSCKA-ILTECR---GGRLVEQQTDCVPEDGSKC--- 68 + +LP D T A+ SS A LT+ + G R+VE+ C PE G C Sbjct 146 DSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIKVATGHRIVEELEICNPESGVSCYFV 205 Query 69 --ESKGGGVFIGLAVAGGLLLLLLTGG-AFFIYKQRQKALPKESSPQRT 114 S G + ++V G L ++L GG A+F+YK+ P +S + Sbjct 206 SVTSMGS---LNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSASHS 251 > ath:AT5G59700 protein kinase, putative Length=829 Score = 33.9 bits (76), Expect = 0.25, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query 61 VPEDGSKCESKGGGVFIGLAVAGGLLLLLLTGGAFFIYKQRQK 103 +P S K G+ IGL + G LL L++ GG F +YK+R + Sbjct 392 LPSGSSSTTKKNVGMIIGLTI-GSLLALVVLGGFFVLYKKRGR 433 > dre:560446 similar to TGF-beta type II receptor; K04388 TGF-beta receptor type-2 [EC:2.7.11.30] Length=576 Score = 32.0 bits (71), Expect = 1.00, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Query 62 PEDGSKCESKGGGVFIGLAVAGGLLLLLLTGGAFFIYKQRQKA-LPKESSPQRTDFVQDE 120 P SK +SK + +++ LL+ ++ AF++Y+ RQ PKE P+RT + + Sbjct 118 PNGFSKLKSKDVIPVVVISLVPPLLVAVIATMAFYLYRTRQPGKKPKEWGPRRTHYQSLD 177 Query 121 AATGRG 126 A G+ Sbjct 178 PAEGQA 183 > dre:100005188 hypothetical LOC100005188 Length=829 Score = 31.2 bits (69), Expect = 1.7, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Query 58 TDCVPEDGSKCESKGGGVFIGLAVAGGLLLLLLTGGAFFIYKQRQKALPKESS 110 T VP+ G S G I + V LLL+ TG A F++ R K LPK+ S Sbjct 113 TVSVPDSGL---SPGAAAGISVIV----LLLVFTGAAAFVFYHRHKFLPKKIS 158 > mmu:21933 Tnfrsf10b, DR5, KILLER, Ly98, MK, TRAILR2, TRICK2A, TRICK2B, TRICKB; tumor necrosis factor receptor superfamily, member 10b; K04722 tumor necrosis factor receptor superfamily member 10 Length=381 Score = 30.4 bits (67), Expect = 2.9, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 12/52 (23%) Query 55 EQQTDCVPEDGSKCESKGG-------GVFIGLAVAGGLLLLLLTGGAFFIYK 99 E+ T C P + KC SK G++IGL V LL+ GA ++K Sbjct 156 EELTSCTPRENRKCVSKTAWASWHKLGLWIGLLVPVVLLI-----GALLVWK 202 > xla:399392 robo1, dutt1, roundabout; roundabout, axon guidance receptor, homolog 1; K06753 roundabout, axon guidance receptor 1 Length=1614 Score = 29.6 bits (65), Expect = 4.5, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%) Query 12 TSVGSLEEEELPHCDPTFPASLGSCDP 38 T ++E+ LP+C PTFP S DP Sbjct 1539 TITNQMQEDILPYCKPTFPTSNNPRDP 1565 > xla:373810 syn2-a, synII, synIIa, synIIb; synapsin II Length=560 Score = 29.6 bits (65), Expect = 4.8, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query 102 QKALPKESSPQRTDFVQDEAATGRGKKRQSDLVQQAEPSL 141 Q +P ++ Q+ DF Q+ A G G+ QSD Q+A P L Sbjct 478 QTTIPHGAAQQQPDFGQE--ALGSGRVSQSDPPQKAHPQL 515 > hsa:6091 ROBO1, DUTT1, FLJ21882, MGC131599, MGC133277, SAX3; roundabout, axon guidance receptor, homolog 1 (Drosophila); K06753 roundabout, axon guidance receptor 1 Length=1551 Score = 29.3 bits (64), Expect = 5.3, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 17 LEEEELPHCDPTFPASLGSCDP 38 ++E+ LP+C PTFP S DP Sbjct 1480 IQEDILPYCRPTFPTSNNPRDP 1501 > mmu:14807 Grik3, 9630027E11, GluR7-3, Glur-7, Glur7; glutamate receptor, ionotropic, kainate 3; K05203 glutamate receptor, ionotropic, kainate 3 Length=919 Score = 29.3 bits (64), Expect = 5.7, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 7/54 (12%) Query 62 PEDGSKCES-----KGGGVFIGLAVAGGLLLLLLTGGAFFIYKQRQKALPKESS 110 PE+ +K S K GG+FI LA GL+L +L FIYK R+ A ++ S Sbjct 806 PEEENKEASALGIQKIGGIFIVLA--AGLVLSVLVAVGEFIYKLRKTAEREQRS 857 > hsa:133482 SLCO6A1, CT48, GST, MGC26949, OATP6A1, OATPY; solute carrier organic anion transporter family, member 6A1; K14357 solute carrier organic anion transporter family, member 6A Length=719 Score = 28.9 bits (63), Expect = 7.5, Method: Composition-based stats. Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 18/84 (21%) Query 57 QTDCVPEDGSKC----------ESKGGGVFIGLAVAGGLLLLLLTGGAFFIYKQRQKALP 106 +T C+ D +KC ++K + +G+ L ++ T AFFIYK+R Sbjct 640 ETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKRRLN--- 696 Query 107 KESSPQRTDFVQDEAATGRGKKRQ 130 + TDF + KK++ Sbjct 697 -----ENTDFPDVTVKNPKVKKKE 715 > ath:AT5G10530 lectin protein kinase, putative Length=651 Score = 28.9 bits (63), Expect = 8.2, Method: Composition-based stats. Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 3/91 (3%) Query 50 GGRLVEQQTDCVPE--DGSKCESKGGGVFIGLAVAGGLLLLLLTGGAFFIYKQRQKALPK 107 G RL+ + E D K ++ G+ IG++V+G +LL K++Q+ Sbjct 242 GNRLLSWEFSSSLELIDIKKSQNDKKGMIIGISVSGFVLLTFFITSLIVFLKRKQQKKKA 301 Query 108 ESSPQRTDFVQD-EAATGRGKKRQSDLVQQA 137 E + T +D E G K DL A Sbjct 302 EETENLTSINEDLERGAGPRKFTYKDLASAA 332 > hsa:642132 roundabout homolog 1-like; K06753 roundabout, axon guidance receptor 1 Length=1615 Score = 28.5 bits (62), Expect = 10.0, Method: Composition-based stats. Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 17 LEEEELPHCDPTFPASLGSCDP 38 ++E+ LP+C PTFP S DP Sbjct 1544 IQEDILPYCRPTFPTSNNPRDP 1565 Lambda K H 0.314 0.133 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3897828240 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40