bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8412_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value Hs14141159 39.3 0.002 At3g20890 39.3 0.002 Hs14141157 39.3 0.002 Hs17438206 38.9 0.002 Hs4826760 38.5 0.003 Hs5031753 37.7 0.005 Hs9624998 37.7 0.005 CE27527_1 34.3 0.052 7292101 33.1 0.12 7299789 33.1 0.13 7299790 33.1 0.14 At5g66010 33.1 0.14 7303049 30.4 0.85 YLR318w 30.0 1.0 Hs19923345 30.0 1.1 Hs18570636 29.6 1.4 Hs13435149 29.6 1.5 Hs8923167 29.6 1.5 Hs4504161 28.9 2.4 7289885 28.5 2.9 7293214 28.1 4.1 ECU02g0250 27.7 5.0 7295524 27.7 5.2 At5g53680 27.7 5.4 7293774 27.3 6.3 SPAC16.02c 27.3 6.9 7299517 27.3 7.5 > Hs14141159 Length=331 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSEDSIIM 88 +R+RGLPFG KE++++FF+G ++ P+ ++ M Sbjct 18 VRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTM 50 > At3g20890 Length=350 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/31 (61%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSEDSI 86 LR+RGLPF A KED+L+FFK ++L SED + Sbjct 264 LRLRGLPFSAGKEDILDFFKDFEL--SEDFV 292 Score = 27.7 bits (60), Expect = 5.8, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 57 RVRGLPFGARKEDLLEFFKG 76 R+RGLPF + D++EFF G Sbjct 118 RLRGLPFDCAELDVVEFFHG 137 > Hs14141157 Length=346 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSEDSIIM 88 +R+RGLPFG KE++++FF+G ++ P+ ++ M Sbjct 18 VRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTM 50 > Hs17438206 Length=126 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 18/79 (22%) Query 22 LNSSGEFKLA-----KTAAHS-AQAFRCMSILHD-------RNRPPR-----LRVRGLPF 63 L S E KLA +T HS +AF+ ++ D RN P +++RGLPF Sbjct 36 LESENEVKLALKKDRETMGHSFVEAFKSNNVEMDWVLKHTGRNSPDTANDGFVQLRGLPF 95 Query 64 GARKEDLLEFFKGYKLAPS 82 KE++++FF G ++ P+ Sbjct 96 ECSKEEIVQFFSGLEIVPN 114 > Hs4826760 Length=415 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 22/27 (81%), Gaps = 0/27 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPS 82 +R+RGLPFG KE++++FF G ++ P+ Sbjct 113 VRLRGLPFGCTKEEIVQFFSGLEIVPN 139 > Hs5031753 Length=449 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 22/27 (81%), Gaps = 0/27 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPS 82 +R+RGLPFG KE++++FF G ++ P+ Sbjct 113 VRLRGLPFGCSKEEIVQFFSGLEIVPN 139 > Hs9624998 Length=449 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 22/27 (81%), Gaps = 0/27 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPS 82 +R+RGLPFG KE++++FF G ++ P+ Sbjct 113 VRLRGLPFGCSKEEIVQFFSGLEIVPN 139 > CE27527_1 Length=607 Score = 34.3 bits (77), Expect = 0.052, Method: Composition-based stats. Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 3/27 (11%) Query 53 PPR---LRVRGLPFGARKEDLLEFFKG 76 PPR +R+RGLPF A ++D+ EFF G Sbjct 60 PPRSQYIRLRGLPFNATEKDIHEFFAG 86 Score = 30.8 bits (68), Expect = 0.60, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSE 83 +R+RG+P+ +++D+ +FF+G + P+E Sbjct 159 IRLRGVPWSCKEDDVRKFFEGLEPPPAE 186 > 7292101 Length=985 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Query 45 SILHDR-NRPP-RLRVRGLPFGARKEDLLEFFKGYKLAPSEDSII 87 SI+ D+ NRP + +R +PF A +D++ FF YKL+P D II Sbjct 898 SIIPDKFNRPGCVVAMRNVPFKAELKDIMRFFSDYKLSP--DDII 940 > 7299789 Length=329 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 55 RLRVRGLPFGARKEDLLEFFKGY 77 R+ V GLP+G R+ DL FFKGY Sbjct 5 RVYVGGLPYGVRERDLERFFKGY 27 > 7299790 Length=132 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 55 RLRVRGLPFGARKEDLLEFFKGY 77 R+ V GLP+G R+ DL FFKGY Sbjct 5 RVYVGGLPYGVRERDLERFFKGY 27 > At5g66010 Length=248 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKL 79 L++RGLP+ K ++EFF GYK+ Sbjct 161 LKMRGLPYSVNKPQIIEFFSGYKV 184 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 54 PRLRVRGLPFGARKEDLLEFFKG 76 P +R+RGLPF D+ EFF G Sbjct 42 PVVRLRGLPFNCADIDIFEFFAG 64 > 7303049 Length=557 Score = 30.4 bits (67), Expect = 0.85, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 8/58 (13%) Query 19 LNVLNSSGE--FKLAKTAAHSAQAFRCMSILHDRNRPPRLRVRGLPFGARKEDLLEFF 74 + V +SGE +A A++ AQAF + +R+RGLP+ A + +L+FF Sbjct 15 IEVYRASGEDFLAIAGGASNEAQAFL------SKGAQVIIRMRGLPYDATAKQVLDFF 66 > YLR318w Length=884 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 18/21 (85%), Gaps = 0/21 (0%) Query 68 EDLLEFFKGYKLAPSEDSIIM 88 +DLLEF+ +K +PS+D++I+ Sbjct 646 DDLLEFYSEFKASPSQDTLIL 666 > Hs19923345 Length=932 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 53 PPRLRVRGLPFGARKEDLLEFFKGYKLAP 81 P ++V+ +PF +++L+FF GY++ P Sbjct 855 PTVIKVQNMPFTVSIDEILDFFYGYQVIP 883 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 7/42 (16%) Query 50 RNRPPR-----LRVRGLPFGARKEDLLEFFKGYKLAPSEDSI 86 R+R P + ++GLPF A + +++FFK KL EDSI Sbjct 421 RSRSPHEAGFCVYLKGLPFEAENKHVIDFFK--KLDIVEDSI 460 > Hs18570636 Length=1001 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSEDSI 86 +++ LPF A ++L+FF GY++ P SI Sbjct 927 IKIMNLPFKANVNEILDFFHGYRIIPDSVSI 957 > Hs13435149 Length=727 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSED 84 +R++G+P+ A +DLL F+ Y+L P++D Sbjct 676 VRMQGVPYTAGMKDLLSVFQAYQL-PADD 703 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLA 80 +R RGLP+ + +D+ FFKG +A Sbjct 259 VRARGLPWQSSDQDVARFFKGLNVA 283 > Hs8923167 Length=358 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLA 80 +R RGLP+ + +D+ FFKG +A Sbjct 67 VRARGLPWQSSDQDIARFFKGLNIA 91 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 15/19 (78%), Gaps = 0/19 (0%) Query 56 LRVRGLPFGARKEDLLEFF 74 +R+RGLP+ A ED+L+F Sbjct 287 IRLRGLPYAATIEDILDFL 305 > Hs4504161 Length=424 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKL 79 +R+RGLP+ ++D+++FF G + Sbjct 196 VRLRGLPYSCNEKDIVDFFAGLNI 219 Score = 27.3 bits (59), Expect = 7.8, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSEDSI 86 +R +GLP+ ED+L FF ++ E+ I Sbjct 96 IRAQGLPWSCTMEDVLNFFSDCRIRNGENGI 126 > 7289885 Length=507 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query 33 TAAHSAQAFRCMSILHDRNRPPRLRVRGLPFGARKEDLLEFFKGYKLA----PSED 84 TA + + F SI H P + LPF A ++DL EFF+G L P ED Sbjct 256 TAPRANRIFDDNSIPH--KAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPRED 309 > 7293214 Length=416 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 55 RLRVRGLPFGARKEDLLEFF 74 RL V +PFG +E+++EFF Sbjct 94 RLYVGNIPFGVTEEEMMEFF 113 > ECU02g0250 Length=246 Score = 27.7 bits (60), Expect = 5.0, Method: Compositional matrix adjust. Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 51 NRPPRLRVRGLPFGARKEDLLEFFKGY 77 +R R+ V G+P + KE++L+FF+ Y Sbjct 78 DRKKRVAVSGIPSDSSKEEVLKFFQYY 104 > 7295524 Length=1713 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 5 RKGIKCLNSQNLIKLNVLNSSGEF 28 +KG++ N QNL LN+L +G F Sbjct 53 QKGVRYYNEQNLTDLNLLQKNGGF 76 > At5g53680 Length=169 Score = 27.7 bits (60), Expect = 5.4, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 55 RLRVRGLPFGARKEDLLEFFK 75 ++ V GLP+ RKE L+ FFK Sbjct 14 KIYVGGLPWTTRKEGLINFFK 34 > 7293774 Length=708 Score = 27.3 bits (59), Expect = 6.3, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 0/35 (0%) Query 53 PPRLRVRGLPFGARKEDLLEFFKGYKLAPSEDSII 87 PP L + + F ED L FKG L+ + DS I Sbjct 488 PPVLAISEVTFRYNPEDPLPIFKGVNLSATSDSRI 522 > SPAC16.02c Length=365 Score = 27.3 bits (59), Expect = 6.9, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 55 RLRVRGLPFGARKEDLLEFFKGY 77 RL V +P A +ED+++FFKGY Sbjct 5 RLFVGRIPPQATREDMMDFFKGY 27 > 7299517 Length=586 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 56 LRVRGLPFGARKEDLLEFFKGYKLAPSEDSII 87 +++RGLP+ ++ + EFF G + + I+ Sbjct 148 VKLRGLPYAVTEQQIEEFFSGLDIKTDREGIL 179 Lambda K H 0.324 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184307974 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40