bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_8141_orf1 Length=59 Score E Sequences producing significant alignments: (Bits) Value At1g03140 43.1 1e-04 Hs4506123 38.5 0.003 Hs4758558 35.4 0.027 CE05372 33.5 0.090 7300471 33.1 0.12 CE27946_2 33.1 0.14 7293972 30.8 0.68 At2g41500 30.0 1.1 SPCC126.14 29.3 2.1 At1g67850 28.5 2.8 CE20741 28.5 2.8 SPAC57A7.05 27.7 5.0 7293735 27.7 5.8 > At1g03140 Length=420 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLM---DDEMPEGQKNVFL 50 EV RRLR +KQP+TLFGE R RL + + + D +M EGQ N FL Sbjct 108 EVIRRLRFLKQPMTLFGEDDQSRLDRLKYVLKEGLFEVDSDMTEGQTNDFL 158 > Hs4506123 Length=342 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 EV RRLR +P+ LFGET ++ +QRL ++E+ + E+ +G +N Sbjct 83 EVIRRLRERGEPIRLFGETDYDAFQRLRKIEI--LTPEVNKGLRN 125 > Hs4758558 Length=522 Score = 35.4 bits (80), Expect = 0.027, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRL 29 +EV LRA+ +P+TLFGE P ER +RL Sbjct 106 SEVKACLRALGEPITLFGEGPAERRERL 133 > CE05372 Length=496 Score = 33.5 bits (75), Expect = 0.090, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 0/39 (0%) Query 3 EVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEM 41 +V +LRA+ QP+ LFGE +R +RL L + +DE+ Sbjct 80 QVKLKLRALNQPICLFGEDALDRRERLRALLSTMSEDEI 118 > 7300471 Length=340 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRLCRLEV 34 TEV RRLR +P+ +FGET E + RL + E+ Sbjct 77 TEVIRRLRERGEPILIFGETEPEAFDRLRQCEI 109 > CE27946_2 Length=1919 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 0/39 (0%) Query 20 ETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEAEE 58 +T +ERYQRL R + LM+D M +KN+F +KE +E Sbjct 689 KTEFERYQRLVREQALLMEDMMLTPEKNLFQFDEKETDE 727 > 7293972 Length=553 Score = 30.8 bits (68), Expect = 0.68, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 0/44 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQ 45 TE+ LR + +P+ FGE P ER +RL L L ++ + + Q Sbjct 135 TEIKSNLRQLNEPICYFGEGPAERRRRLKELLAGLGENAINKRQ 178 > At2g41500 Length=554 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 7 RLRAIKQPVTLFGETPWERYQRLCRL 32 RLR + +P+TLFGE ER RL +L Sbjct 129 RLRRLGEPITLFGEQEMERRARLTQL 154 > SPCC126.14 Length=343 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRLCRL 32 TE+ +LR +K+P+ LFGE+ QR L Sbjct 127 TEIIAKLREMKEPIRLFGESEEATIQRYYSL 157 > At1g67850 Length=332 Score = 28.5 bits (62), Expect = 2.8, Method: Compositional matrix adjust. Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 0/41 (0%) Query 19 GETPWERYQRLCRLEVQLMDDEMPEGQKNVFLSLQKEAEEE 59 G+ PW+ + C+ E + M +K+ F SLQ E Sbjct 286 GKAPWQGVRDRCKKEWTMFQSRMANAEKDYFKSLQVEGSSN 326 > CE20741 Length=348 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query 2 TEVFRRLRAIKQPVTLFGETPWERYQRLCRLEVQLMDDEMPEGQKN 47 +E+ RLR P+ LFGET + +RL +LE L ++ EG +N Sbjct 88 SEIQTRLRQRNHPIMLFGETDIDVRKRLHQLE--LAQPDLNEGWEN 131 > SPAC57A7.05 Length=1337 Score = 27.7 bits (60), Expect = 5.0, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 7 RLRAIKQPVTLFGETPWERYQRLCRLEVQLMD 38 RL + + G P E+YQ LC+ +++L+D Sbjct 1143 RLNMVNFEPSFKGRWPMEKYQLLCKTQLELVD 1174 > 7293735 Length=459 Score = 27.7 bits (60), Expect = 5.8, Method: Compositional matrix adjust. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Query 15 VTLFGETPWERYQRLCRLEVQLMDDEMPEGQK 46 VT +GE R QRL +LE QL D+ + E Q+ Sbjct 39 VTQYGE----RKQRLAKLEAQLKDESLSEAQR 66 Lambda K H 0.318 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184950242 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40