bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6597_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value 7302948 40.4 8e-04 Hs7657473 33.1 0.12 SPAC21E11.05c 32.3 0.20 At5g67530 32.3 0.23 CE02318 27.3 6.9 CE25100 26.9 8.2 At1g32090 26.9 8.3 CE28076 26.9 9.7 > 7302948 Length=517 Score = 40.4 bits (93), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 0/49 (0%) Query 1 GGLQVLRAWETIPVDSRDRPQRPLFIQKMHIFKNGIEEAKLKLEKEKNE 49 GGL L+ E I VD++DRP + I+ +F N EA +L KE+ E Sbjct 402 GGLDTLQKMENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQLAKEREE 450 > Hs7657473 Length=520 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Query 1 GGLQVLRAWETIPVDSR-DRPQRPLFIQKMHIFKNGIEEAKLKLEKEKNEKLNRQAEEAK 59 GG VL A E + D + DRP+ + I +F + EEA ++ +E+ +L E Sbjct 402 GGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKV 461 Query 60 AQARP 64 ++P Sbjct 462 KSSQP 466 > SPAC21E11.05c Length=471 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 1 GGLQVLRAWETIPVDSRDRPQRPLFIQKMHIF 32 GGL VL A E +P +S D P+ P+ ++ + IF Sbjct 353 GGLNVLDALEKVPTNSNDHPKLPIKLEDIIIF 384 > At5g67530 Length=595 Score = 32.3 bits (72), Expect = 0.23, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 0/34 (0%) Query 1 GGLQVLRAWETIPVDSRDRPQRPLFIQKMHIFKN 34 GGL L A E +PVD DRP + I + +F N Sbjct 466 GGLATLAAMENVPVDESDRPLEEIKIIEASVFVN 499 > CE02318 Length=672 Score = 27.3 bits (59), Expect = 6.9, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 9/63 (14%) Query 11 TIPVDS--RDRPQRPLFIQKMH-IFKNGIEEAKLKLEKEKNEKLNRQAEE------AKAQ 61 T+P S D +R L+ Q+ + I + IEEA+ K E E+NEK+ + E ++ Sbjct 365 TLPFTSTASDDEERMLYDQRRNGIPRALIEEAERKRENEQNEKIEQLTEMIDPIIVVRSM 424 Query 62 ARP 64 ARP Sbjct 425 ARP 427 > CE25100 Length=666 Score = 26.9 bits (58), Expect = 8.2, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 9/63 (14%) Query 11 TIPVDS--RDRPQRPLFIQKMH-IFKNGIEEAKLKLEKEKNEKLNRQAEE------AKAQ 61 T+P S D +R L+ Q+ + I + IEEA+ K E E+NEK+ + E ++ Sbjct 365 TLPFTSTASDDEERMLYDQRRNGIPRALIEEAERKRENEQNEKIEQLTEMIDPIIVVRSM 424 Query 62 ARP 64 ARP Sbjct 425 ARP 427 > At1g32090 Length=806 Score = 26.9 bits (58), Expect = 8.3, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 39 AKLKLEKEKNEKLNRQAEEAKAQARPWFNN 68 AK KLEKE +LN +A+ A A P F++ Sbjct 689 AKDKLEKETEPELNMKADLADAYLHPIFHS 718 > CE28076 Length=625 Score = 26.9 bits (58), Expect = 9.7, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 9/63 (14%) Query 11 TIPVDS--RDRPQRPLFIQKMH-IFKNGIEEAKLKLEKEKNEKLNRQAEE------AKAQ 61 T+P S D +R L+ Q+ + I + IEEA+ K E E+NEK+ + E ++ Sbjct 324 TLPFTSTASDDEERMLYDQRRNGIPRALIEEAERKRENEQNEKIEQLTEMIDPIIVVRSM 383 Query 62 ARP 64 ARP Sbjct 384 ARP 386 Lambda K H 0.316 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40