bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6593_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value 7295550 59.7 1e-09 Hs4557415 56.6 1e-08 CE20851 55.5 2e-08 CE25661 52.8 1e-07 At1g55880 48.5 3e-06 YGR155w 39.7 0.001 SPBC36.04 35.4 0.025 At4g00900 31.6 0.40 SPAC3A12.17c 29.6 1.3 At1g07810 29.3 2.1 At1g07670 28.9 2.1 Hs4758750_1 28.5 3.3 Hs18598265 28.1 3.7 CE18885 28.1 4.3 CE18884 28.1 4.4 Hs10835220 28.1 4.5 7291680 27.7 4.8 Hs4502285 27.7 5.2 Hs13994259 27.7 5.4 Hs4885077 27.7 5.9 At1g10130 27.7 6.0 CE24780 27.3 6.1 7294406 27.3 6.3 > 7295550 Length=522 Score = 59.7 bits (143), Expect = 1e-09, Method: Composition-based stats. Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%) Query 23 SHLARELPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 +H + P+IL+ IGCTPLV L+ + + G+ C++ KCEFL+ GGS+KD Sbjct 40 AHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKD 89 > Hs4557415 Length=551 Score = 56.6 bits (135), Expect = 1e-08, Method: Composition-based stats. Identities = 24/44 (54%), Positives = 33/44 (75%), Gaps = 0/44 (0%) Query 29 LPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 LP IL IG TP+V ++++G G+ C+LL KCEF +AGGS+KD Sbjct 77 LPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD 120 > CE20851 Length=755 Score = 55.5 bits (132), Expect = 2e-08, Method: Composition-based stats. Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 0/44 (0%) Query 29 LPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 L S+LDAIG TPLV L V A GV C + KCEFL+AGGS KD Sbjct 337 LDSVLDAIGKTPLVKLQHVPKAHGVRCNVYVKCEFLNAGGSTKD 380 > CE25661 Length=700 Score = 52.8 bits (125), Expect = 1e-07, Method: Composition-based stats. Identities = 24/44 (54%), Positives = 31/44 (70%), Gaps = 0/44 (0%) Query 29 LPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 L ++LDAIG TPLV L + A GV C + KCE+++AGGS KD Sbjct 375 LDTVLDAIGKTPLVKLQHIPKAHGVKCNVYVKCEYMNAGGSTKD 418 > At1g55880 Length=421 Score = 48.5 bits (114), Expect = 3e-06, Method: Composition-based stats. Identities = 22/41 (53%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Query 32 ILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 ++DAIG TPL+ ++ + A G C++LGKCEFL+ GGS+KD Sbjct 44 LVDAIGNTPLIRINSLSEATG--CEILGKCEFLNPGGSVKD 82 > YGR155w Length=507 Score = 39.7 bits (91), Expect = 0.001, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 0/42 (0%) Query 31 SILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 +++D +G TPL+ L ++ A G+ Q+ K E + GGS+KD Sbjct 13 NVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKD 54 > SPBC36.04 Length=351 Score = 35.4 bits (80), Expect = 0.025, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query 23 SHLARELPSILD----AIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 S + ++P I+ AIG TPL+ L+ + G C +L K EF + GGS+KD Sbjct 4 SGIQTKVPGIVSGFIGAIGRTPLIRLNTLSNETG--CNILAKAEFQNPGGSVKD 55 > At4g00900 Length=1054 Score = 31.6 bits (70), Expect = 0.40, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGG 68 ++ + R+LPS+ + +GCT ++C + GT ++ + EF + GG Sbjct 346 KNAIVRKLPSV-ETLGCTTVICSDKTGT---LTTNQMSATEFFTLGG 388 > SPAC3A12.17c Length=395 Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query 36 IGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 IG T +V + + A G C +L K EFL+ G S KD Sbjct 50 IGNTKMVRIKSLSQATG--CDILAKAEFLNPGNSPKD 84 > At1g07810 Length=1061 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 8/72 (11%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAG---GSMKDMKRNGC 78 ++ L R+LPS+ + +GCT ++C + GT ++ + + ++ G G+++ G Sbjct 361 KNALVRKLPSV-ETLGCTTVICSDKTGT---LTTNQMAVSKLVAMGSRIGTLRSFNVEGT 416 Query 79 GNDHRS-KLENF 89 D R K+E++ Sbjct 417 SFDPRDGKIEDW 428 > At1g07670 Length=1061 Score = 28.9 bits (63), Expect = 2.1, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 8/72 (11%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAG---GSMKDMKRNGC 78 ++ L R+LPS+ + +GCT ++C + GT ++ + + ++ G G+++ G Sbjct 361 KNALVRKLPSV-ETLGCTTVICSDKTGT---LTTNQMAVSKLVAMGSRIGTLRSFNVEGT 416 Query 79 GNDHRS-KLENF 89 D R K+E++ Sbjct 417 SFDPRDGKIEDW 428 > Hs4758750_1 Length=1144 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 0/36 (0%) Query 41 LVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKDMKRN 76 L LS+ G A+GV +LG C L A G+ K N Sbjct 256 LTALSQKGYASGVERTILGACPVLEAFGNAKTAHNN 291 > Hs18598265 Length=292 Score = 28.1 bits (61), Expect = 3.7, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 39 TPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKD 72 TP +C S+VG + + C + G + +AGG+ +D Sbjct 256 TPTICGSQVGKSHHLLCWMPGPPSWGTAGGARED 289 > CE18885 Length=1004 Score = 28.1 bits (61), Expect = 4.3, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGT 49 ++ + R LPS+ + +GCT ++C + GT Sbjct 331 KNAIVRSLPSV-ETLGCTSVICSDKTGT 357 > CE18884 Length=1059 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGT 49 ++ + R LPS+ + +GCT ++C + GT Sbjct 331 KNAIVRSLPSV-ETLGCTSVICSDKTGT 357 > Hs10835220 Length=994 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGT 49 ++ + R LPS+ + +GCT ++C + GT Sbjct 329 KNAIVRSLPSV-ETLGCTSVICSDKTGT 355 > 7291680 Length=1020 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGT 49 ++ + R LPS+ + +GCT ++C + GT Sbjct 329 KNAIVRSLPSV-ETLGCTSVICSDKTGT 355 > Hs4502285 Length=997 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGT 49 ++ + R LPS+ + +GCT ++C + GT Sbjct 329 KNAIVRSLPSV-ETLGCTSVICSDKTGT 355 > Hs13994259 Length=430 Score = 27.7 bits (60), Expect = 5.4, Method: Composition-based stats. Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Query 29 LPSILDAIGCTPLVCLSRVGTAAGVSCQL--LGKCEFLSAGGSMKDMKRNGCGNDHRSKL 86 + + + A+GC P++C G G C L L L+ + + + G Sbjct 1 MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPY 60 Query 87 ENFSQSLESLKYISSP 102 + S++L++ ISSP Sbjct 61 ASLSRALQTQCCISSP 76 > Hs4885077 Length=999 Score = 27.7 bits (60), Expect = 5.9, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query 22 QSHLARELPSILDAIGCTPLVCLSRVGT 49 ++ + R LPS+ + +GCT ++C + GT Sbjct 329 KNAIVRSLPSV-ETLGCTSVICSDKTGT 355 > At1g10130 Length=992 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query 25 LARELPSILDAIGCTPLVCLSRVGT 49 + R LPS+ + +GCT ++C + GT Sbjct 322 IVRSLPSV-ETLGCTTVICSDKTGT 345 > CE24780 Length=461 Score = 27.3 bits (59), Expect = 6.1, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 67 GGSMKDMKRNGCGNDHRSKLENFSQSLESLKYIS 100 GG +K++ GC N H S L F+ +L+++S Sbjct 122 GGFLKELSLKGCENVHDSALRTFTSRCPNLEHLS 155 > 7294406 Length=750 Score = 27.3 bits (59), Expect = 6.3, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 8/62 (12%) Query 36 IGCTPLVCLSRVGTAAGVSCQLLGKCEFLSAGGSMKDMKRNGCGN------DH--RSKLE 87 +G T S V AGVS Q L K L GG + DM + C DH ++K+E Sbjct 1 MGNTESNVTSGVKKQAGVSTQALYKFVNLKGGGLLVDMMKRACQTKQFAEIDHAIKTKVE 60 Query 88 NF 89 F Sbjct 61 PF 62 Lambda K H 0.318 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164169380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40