bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6580_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value Hs17999537 34.7 0.041 7303518 28.5 2.8 CE00122 28.5 2.8 At5g16180 28.5 2.9 At5g56780 27.3 6.6 > Hs17999537 Length=2335 Score = 34.7 bits (78), Expect = 0.041, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query 50 EYLAALEPFGWVRISPSTSSELEDQESDTSPSRTADE-LLDGEAS 93 EYL +EP GW+ P+ S +L Q+ T AD DGE + Sbjct 2167 EYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKT 2211 > 7303518 Length=2396 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 48 SEEYLAALEPFGWVRISPSTSSELEDQESDT 78 + +YL +EP GW+ P+ +L Q+ T Sbjct 2225 THQYLKDMEPLGWIHTQPNELPQLSPQDITT 2255 > CE00122 Length=2329 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 26/64 (40%), Gaps = 11/64 (17%) Query 31 NLPSQIDPLVSSAEADASEEYLAALEPFGWVRISPSTSSELEDQESDTSPSRTADEL-LD 89 NLP+Q+ E L EP GW+ P+ +L Q+ T D + D Sbjct 2151 NLPTQL----------PDHELLRDFEPLGWMHTQPNELPQLSPQDVTTHAKLLTDNISWD 2200 Query 90 GEAS 93 GE + Sbjct 2201 GEKT 2204 > At5g16180 Length=718 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 62 RISPSTSSELEDQESDTSPSRTADELLDG 90 R PS SSE +D+ S + R AD LLDG Sbjct 288 RGGPSYSSEGQDEISSSLYEREADRLLDG 316 > At5g56780 Length=488 Score = 27.3 bits (59), Expect = 6.6, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 0/64 (0%) Query 9 TVRAPAENAAGSQSTYRFEDGGNLPSQIDPLVSSAEADASEEYLAALEPFGWVRISPSTS 68 T+ +P + G F GG++ + P+ S EA+A+E L + + W + S Sbjct 130 TIESPVKAVTGGLFEDIFSKGGSILYRWAPMGSKREAEATEGMLLSTFDYAWNKGSNGER 189 Query 69 SELE 72 +L+ Sbjct 190 RQLD 193 Lambda K H 0.303 0.121 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1160968786 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40