bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_6428_orf3 Length=50 Score E Sequences producing significant alignments: (Bits) Value Hs4557026 47.4 7e-06 Hs15147337 43.1 1e-04 7291760 40.0 0.001 Hs13375805 40.0 0.001 At3g53090 40.0 0.001 Hs22061896 40.0 0.001 YGL141w 39.3 0.002 CE24948 38.1 0.004 Hs4758520 38.1 0.004 SPAC167.07c 37.7 0.005 7295004 37.7 0.005 CE15744 37.0 0.008 At5g02880_2 37.0 0.010 At4g12570 36.6 0.011 CE25443 36.6 0.012 Hs10863903_2 36.2 0.016 Hs13929476 36.2 0.017 At3g17205 35.8 0.017 Hs19718766 35.4 0.022 Hs19718762 35.4 0.024 Hs19718764 35.4 0.025 At4g38600 35.0 0.033 CE17508 35.0 0.037 Hs5902156 34.3 0.052 Hs22067492 34.3 0.057 HsM14010859 33.9 0.073 7294742 33.9 0.077 CE19147 33.9 0.079 Hs21361973 33.9 0.080 At1g55860 33.9 0.081 ECU10g1380 33.5 0.085 7293111 33.5 0.11 Hs21361472 33.5 0.11 Hs7661856 33.1 0.11 HsM14719404 33.1 0.11 Hs15300020 33.1 0.12 YKL010c_2 33.1 0.12 At1g70320 32.7 0.17 Hs14759464 32.3 0.20 Hs13654239 32.3 0.21 Hs12232397 31.6 0.38 Hs20474127 31.2 0.47 Hs20539203 31.2 0.52 Hs22062809 30.8 0.64 CE27342 30.8 0.69 SPAC12B10.01c 30.8 0.69 Hs14730213 30.8 0.70 7291075 30.4 0.77 SPBC16E9.11c 30.0 1.2 YDR457w 29.6 1.4 > Hs4557026 Length=4861 Score = 47.4 bits (111), Expect = 7e-06, Method: Composition-based stats. Identities = 22/38 (57%), Positives = 28/38 (73%), Gaps = 0/38 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCTAI 50 + LPT+ TC F+L +P YSS VM ERL YAI+NC +I Sbjct 4803 DSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSI 4840 > Hs15147337 Length=2799 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Query 5 QRLPAI-----NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 Q +P+I +D LPTA TC RL VPLYSS +++++LL AI Sbjct 2747 QPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAI 2791 > 7291760 Length=1122 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 0/38 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCTAI 50 RLPTA+TC+ L +P + +V MRE+LLYAI + Sbjct 1082 ERLPTASTCTNLLKLPPFKTVEQMREKLLYAIQSGAGF 1119 > Hs13375805 Length=210 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAISNCTAI 50 LP ++TCS L +P Y+S V E+L YA NC AI Sbjct 166 LPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAI 201 > At3g53090 Length=1142 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 0/34 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 RLP+A+TC L +P Y S MRE+LLYAI++ Sbjct 1102 ERLPSASTCYNTLKLPTYKRASTMREKLLYAITS 1135 > Hs22061896 Length=1068 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 RLPT++TC L +P YS SV+RE+L YAIS Sbjct 1029 RLPTSSTCFNLLKLPNYSKKSVLREKLRYAIS 1060 > YGL141w Length=910 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 26/33 (78%), Gaps = 0/33 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 RLPTA+TC L +P Y + +++RE+LLYAI++ Sbjct 871 RLPTASTCVNLLKLPDYRNKTILREKLLYAINS 903 > CE24948 Length=2944 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 LPTA TC RL VP+YSS V+R +LL AI Sbjct 2907 LPTANTCISRLYVPVYSSKRVLRTKLLLAI 2936 > Hs4758520 Length=4834 Score = 38.1 bits (87), Expect = 0.004, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCTAI 50 D+ LP + TC F L +P YS V+ E+L YAI C +I Sbjct 4753 DHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSI 4791 > SPAC167.07c Length=1029 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 0/39 (0%) Query 6 RLPAINDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 R+ ++ RLPTA+TC L +P+YS+ +R++LL A+ Sbjct 982 RVNGEDETRLPTASTCVNLLKLPMYSTKQTLRDKLLTAV 1020 > 7295004 Length=1078 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 0/37 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCTA 49 NRLPT++TC L +P Y S +R++L YA+S+ T Sbjct 1038 NRLPTSSTCFNLLKLPNYQKKSTLRDKLRYAVSSNTG 1074 > CE15744 Length=1001 Score = 37.0 bits (84), Expect = 0.008, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 0/36 (0%) Query 11 NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 +D+ LPT+ATC L +P YS+ + + E+L YAI++ Sbjct 959 SDDELPTSATCMNMLRIPKYSNRTKLEEKLRYAINS 994 > At5g02880_2 Length=628 Score = 37.0 bits (84), Expect = 0.010, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 0/35 (0%) Query 11 NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 +D LP+ TC+ L +P YSS M+E+L+YAI+ Sbjct 585 SDTDLPSVMTCANYLKLPPYSSKEKMKEKLIYAIT 619 > At4g12570 Length=873 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Query 6 RLPAINDNRLPTAATCSFRLVVPLYSSVSVMRERL 40 RL ND RLP + TC +RL +P Y ++++M +RL Sbjct 825 RLYEAND-RLPLSHTCFYRLCIPRYPTITLMEQRL 858 > CE25443 Length=875 Score = 36.6 bits (83), Expect = 0.012, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 +RLP A TC +L +P Y S +R+ LL AI CT Sbjct 834 DRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECT 869 > Hs10863903_2 Length=650 Score = 36.2 bits (82), Expect = 0.016, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 8/43 (18%) Query 1 ENPDQRLPAINDNRLPTAATCSFRLVVPLYSSVSVMRERLLYA 43 ENPD LP++ TC L +P YSS+ +MRE+LL A Sbjct 605 ENPDDFLPSV--------MTCVNYLKLPDYSSIEIMREKLLIA 639 > Hs13929476 Length=308 Score = 36.2 bits (82), Expect = 0.017, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 +RLP+A TC +L +P Y S +R LL AI C+ Sbjct 267 DRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECS 302 > At3g17205 Length=873 Score = 35.8 bits (81), Expect = 0.017, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 0/33 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 +RLPT+ATC L +P Y S ++ +L+YAIS Sbjct 833 DRLPTSATCMNLLKLPPYQSKELLETKLMYAIS 865 > Hs19718766 Length=875 Score = 35.4 bits (80), Expect = 0.022, Method: Composition-based stats. Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 RLPT+ TC L++P YSS ++ERLL AI+ Sbjct 836 RLPTSHTCFNVLLLPEYSSKEKLKERLLKAIT 867 > Hs19718762 Length=852 Score = 35.4 bits (80), Expect = 0.024, Method: Composition-based stats. Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 RLPT+ TC L++P YSS ++ERLL AI+ Sbjct 813 RLPTSHTCFNVLLLPEYSSKEKLKERLLKAIT 844 > Hs19718764 Length=872 Score = 35.4 bits (80), Expect = 0.025, Method: Composition-based stats. Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 RLPT+ TC L++P YSS ++ERLL AI+ Sbjct 833 RLPTSHTCFNVLLLPEYSSKEKLKERLLKAIT 864 > At4g38600 Length=757 Score = 35.0 bits (79), Expect = 0.033, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 0/34 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 D+ LP+ TC+ L +P YS+ +M ++LLYAI+ Sbjct 715 DDDLPSVMTCANYLKLPPYSTKEIMYKKLLYAIN 748 > CE17508 Length=2761 Score = 35.0 bits (79), Expect = 0.037, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 11 NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 D P+ TC L +P YSS +++RERLL AI Sbjct 2720 GDGSYPSVNTCVHYLKLPEYSSSAILRERLLTAI 2753 > Hs5902156 Length=870 Score = 34.3 bits (77), Expect = 0.052, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 LP + TC RL +P Y S +RE+LLYAI Sbjct 832 LPRSHTCFNRLDLPPYKSYEQLREKLLYAI 861 > Hs22067492 Length=870 Score = 34.3 bits (77), Expect = 0.057, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 LP + TC RL +P Y S +RE+LLYAI Sbjct 832 LPRSHTCFNRLDLPPYKSYEQLREKLLYAI 861 > HsM14010859 Length=862 Score = 33.9 bits (76), Expect = 0.073, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 +N LP + TC RL +P Y S ++E+LL+AI Sbjct 821 ENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAI 853 > 7294742 Length=973 Score = 33.9 bits (76), Expect = 0.077, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 0/35 (0%) Query 11 NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 + +RLPT+ TC L++P YSS + ERL+ AI+ Sbjct 931 DSDRLPTSHTCFNVLLLPEYSSREKLEERLMKAIN 965 > CE19147 Length=1066 Score = 33.9 bits (76), Expect = 0.079, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 RLPTA+TC L +P Y+ S++ E+L YAI Sbjct 1027 RLPTASTCFNLLKLPNYNKKSLLLEKLRYAI 1057 > Hs21361973 Length=903 Score = 33.9 bits (76), Expect = 0.080, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 +N LP + TC RL +P Y S ++E+LL+AI Sbjct 862 ENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAI 894 > At1g55860 Length=3891 Score = 33.9 bits (76), Expect = 0.081, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 RLP+A TC +L +P Y S ++ERLL AI + Sbjct 3850 ERLPSAHTCFNQLDLPEYQSKEQLQERLLLAIHEAS 3885 > ECU10g1380 Length=2410 Score = 33.5 bits (75), Expect = 0.085, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 + LPTA TC +LV+P YSS + + L AI+ C+ Sbjct 2369 DSLPTAHTCFNQLVLPEYSSYENLLKYLTLAINECS 2404 > 7293111 Length=5002 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 +RLP A TC +L +P+Y S +R LL AI C+ Sbjct 4961 DRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECS 4996 > Hs21361472 Length=955 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 +LP A TC RL +P Y + +RE+LL A+ N Sbjct 915 KLPRAHTCFNRLDLPPYETFEDLREKLLMAVEN 947 > Hs7661856 Length=1083 Score = 33.1 bits (74), Expect = 0.11, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISNCTA 49 RLPTA+TC L +P + +++R +LLYAI C A Sbjct 1043 ERLPTASTCMNLLKLPEFYDETLLRSKLLYAI-ECAA 1078 > HsM14719404 Length=854 Score = 33.1 bits (74), Expect = 0.11, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 14 RLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 +LP A TC RL +P Y + +RE+LL A+ N Sbjct 814 KLPRAHTCFNRLDLPPYETFEDLREKLLMAVEN 846 > Hs15300020 Length=1592 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYA 43 D P+ TC L +P YSS +MRERLL A Sbjct 1552 DASYPSVNTCVHYLKLPEYSSEEIMRERLLAA 1583 > YKL010c_2 Length=470 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 D LP+ TC+ L +P Y+S +MR RL AI Sbjct 428 DEYLPSVMTCANYLKLPKYTSKDIMRSRLCQAI 460 > At1g70320 Length=3658 Score = 32.7 bits (73), Expect = 0.17, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 RLP+A TC +L +P Y S ++ERLL AI Sbjct 3617 ERLPSAHTCFNQLDLPEYQSKEQVQERLLLAI 3648 > Hs14759464 Length=562 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 N LPT++TC L +P Y S ++++RLL A+ Sbjct 521 NLLPTSSTCINMLKLPEYPSKEILKDRLLVAL 552 > Hs13654239 Length=922 Score = 32.3 bits (72), Expect = 0.21, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 12 DNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 D LP + TC RL +P Y S ++E+LL+AI Sbjct 881 DTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAI 913 > Hs12232397 Length=748 Score = 31.6 bits (70), Expect = 0.38, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 N LP A TC R+ +P Y S + E+LL AI Sbjct 708 NNLPKAHTCFNRIDIPPYESYEKLYEKLLTAI 739 > Hs20474127 Length=218 Score = 31.2 bits (69), Expect = 0.47, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 N LP A TC +L +P Y S ++++L+ ISN Sbjct 178 NCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISN 211 > Hs20539203 Length=757 Score = 31.2 bits (69), Expect = 0.52, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 11 NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 N + LP A TC R+ +P Y S + E+LL A+ Sbjct 715 NTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAV 748 > Hs22062809 Length=1606 Score = 30.8 bits (68), Expect = 0.64, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 LP A TC RL +P Y S S++ E+LL A+ + Sbjct 1568 LPRAHTCFNRLDLPPYPSYSMLYEKLLTAVEETS 1601 > CE27342 Length=810 Score = 30.8 bits (68), Expect = 0.69, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 LP A TC RL +P Y++ ++ +LL AI N Sbjct 771 LPRAHTCFNRLDLPPYTTFKELKSKLLTAIEN 802 > SPAC12B10.01c Length=400 Score = 30.8 bits (68), Expect = 0.69, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 8 PAINDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 P + D+ LP+ TC L +P YSS V+ RL AI Sbjct 354 PYVPDDYLPSVMTCVNYLKLPEYSSSEVLGSRLSKAI 390 > Hs14730213 Length=1572 Score = 30.8 bits (68), Expect = 0.70, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 15 LPTAATCSFRLVVPLYSSVSVMRERLLYAISNCT 48 LP A TC RL +P Y S S++ E+LL A+ + Sbjct 1534 LPRAHTCFNRLDLPPYPSFSMLYEKLLTAVEETS 1567 > 7291075 Length=388 Score = 30.4 bits (67), Expect = 0.77, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAI 44 N LP A TC RL +P Y + ++ E+LL A+ Sbjct 348 NALPRAHTCFNRLDLPPYPTPELLYEKLLLAV 379 > SPBC16E9.11c Length=786 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 13 NRLPTAATCSFRLVVPLYSSVSVMRERLLYAISN 46 ++LP A TC RL +P Y S + E+L A+ N Sbjct 746 DQLPVAHTCFNRLDLPDYPSKDTLHEKLSLAVEN 779 > YDR457w Length=3268 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 0/35 (0%) Query 11 NDNRLPTAATCSFRLVVPLYSSVSVMRERLLYAIS 45 + RLP++ TC +L +P Y S +R LL AI+ Sbjct 3225 SSERLPSSHTCFNQLNLPPYESYETLRGSLLLAIN 3259 Lambda K H 0.322 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164550556 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40