bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5843_orf1 Length=62 Score E Sequences producing significant alignments: (Bits) Value YDL029w 30.4 0.83 7293239 30.0 1.2 Hs5031571 29.3 2.0 7292092_3 28.9 2.5 CE06111 28.5 3.1 > YDL029w Length=391 Score = 30.4 bits (67), Expect = 0.83, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Query 14 PLLENFYLSHFERYLDVQG-DTLRPLFKLYLRRQIVLN---DFPRTQREVQQQ 62 P+ E+ LSH R LDV G D R L L RR N DF T R+++++ Sbjct 167 PVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF-ETVRQIKEK 218 > 7293239 Length=394 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query 14 PLLENFYLSHFERYLDVQG-DTLRPLFKLYLRRQIVLN 50 P+ E F L H R LD+ G D R L KL L R N Sbjct 168 PVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAFN 205 > Hs5031571 Length=394 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Query 14 PLLENFYLSHFERYLDVQG-DTLRPLFKLYLRRQIVLN---DFPRTQREVQQQ 62 P+ E F L H R LD+ G D R L KL L R N DF T R ++++ Sbjct 168 PVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADF-ETVRMIKEK 219 > 7292092_3 Length=572 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 16 LENFYLSHFERYLDVQGDTLRPLFKLYLRRQIVLNDF 52 LENF +H + Y+ +GD PL ++Y Q +L + Sbjct 207 LENFNWNHMDLYICTRGDVDYPLMEVYPGAQRILANL 243 > CE06111 Length=395 Score = 28.5 bits (62), Expect = 3.1, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query 14 PLLENFYLSHFERYLDVQG-DTLRPLFKLYLRR 45 P+ E F L H R LD+ G D + L KL L+R Sbjct 168 PVYEGFALHHLTRRLDIAGRDITKYLIKLLLQR 200 Lambda K H 0.323 0.143 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40