bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5812_orf3 Length=57 Score E Sequences producing significant alignments: (Bits) Value Hs19924111 46.6 1e-05 HsM5174645 46.2 2e-05 CE15561 43.5 9e-05 SPCC70.03c 42.0 3e-04 7295507 40.4 9e-04 At3g30775 32.3 0.23 At5g38710 31.6 0.33 YBR263w 28.1 4.2 > Hs19924111 Length=600 Score = 46.6 bits (109), Expect = 1e-05, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 30/39 (76%), Gaps = 0/39 (0%) Query 19 LLVDAEQSTLQAFIHLITVQAQKKYNLERPVIVNTYQAY 57 L+VDAEQ+ Q I +T++ Q+K+N+E+P+I NTYQ Y Sbjct 377 LMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCY 415 > HsM5174645 Length=516 Score = 46.2 bits (108), Expect = 2e-05, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 30/39 (76%), Gaps = 0/39 (0%) Query 19 LLVDAEQSTLQAFIHLITVQAQKKYNLERPVIVNTYQAY 57 L+VDAEQ+ Q I +T++ Q+K+N+E+P+I NTYQ Y Sbjct 293 LMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCY 331 > CE15561 Length=564 Score = 43.5 bits (101), Expect = 9e-05, Method: Composition-based stats. Identities = 23/44 (52%), Positives = 29/44 (65%), Gaps = 0/44 (0%) Query 14 QKPTMLLVDAEQSTLQAFIHLITVQAQKKYNLERPVIVNTYQAY 57 +K ++VDAEQ+ LQ I IT++ KKYN R I NTYQAY Sbjct 331 EKGVRIMVDAEQTYLQPAISKITIEMMKKYNKGRGNIFNTYQAY 374 > SPCC70.03c Length=492 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 8/57 (14%) Query 1 CEYAAQQQQQQQHQKPTMLLVDAEQSTLQAFIHLITVQAQKKYNLERPVIVNTYQAY 57 C++A ++Q L +DAEQ+ Q +H +TV +KYN E ++ NTYQ Y Sbjct 254 CQFAKEKQ--------IPLFIDAEQTYFQDCMHAVTVDLMRKYNKEVAIVHNTYQLY 302 > 7295507 Length=671 Score = 40.4 bits (93), Expect = 9e-04, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 27/39 (69%), Gaps = 0/39 (0%) Query 19 LLVDAEQSTLQAFIHLITVQAQKKYNLERPVIVNTYQAY 57 ++VDAEQ+ Q I IT++ +KYN ++ ++ NTYQ Y Sbjct 435 IMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCY 473 > At3g30775 Length=499 Score = 32.3 bits (72), Expect = 0.23, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Query 19 LLVDAEQSTLQAFIHLITVQAQKKYNLE--RPVIVNTYQAY 57 LL+DAE + LQ I + + +N + RP++ NT QAY Sbjct 279 LLIDAEDTILQPAIDYMAYSSAIMFNADKDRPIVYNTIQAY 319 > At5g38710 Length=476 Score = 31.6 bits (70), Expect = 0.33, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Query 19 LLVDAEQSTLQAFIHLITVQAQKKYNLE--RPVIVNTYQAY 57 LL+DAE + LQ I + + +N + RP++ NT QAY Sbjct 258 LLIDAEDTILQPAIDYMAYWSAIMFNSDKDRPIVYNTIQAY 298 > YBR263w Length=565 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 0/41 (0%) Query 8 QQQQQHQKPTMLLVDAEQSTLQAFIHLITVQAQKKYNLERP 48 QQ++ QK ++ L+ +E T +A + L+ + Q KY+ P Sbjct 120 QQERHRQKHSITLIPSENFTSKAVMDLLGSELQNKYSEGYP 160 Lambda K H 0.318 0.125 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1191047922 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40