bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5498_orf1 Length=93 Score E Sequences producing significant alignments: (Bits) Value At5g43530 32.0 0.28 At2g02090 30.4 0.81 CE16277 30.4 0.85 SPCC1235.05c 30.0 0.97 At3g31920 28.5 3.0 At1g61140 28.1 3.7 Hs15805014 28.1 4.5 At3g12810 27.7 4.8 7298963 27.7 5.0 > At5g43530 Length=1277 Score = 32.0 bits (71), Expect = 0.28, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query 42 LLFRLRRICNHSLLMQGRYTSEQK---DRMARHY 72 LL RLR+ CNH L+ R S+Q D +AR + Sbjct 974 LLLRLRQCCNHPFLVMSRADSQQYADLDSLARRF 1007 > At2g02090 Length=763 Score = 30.4 bits (67), Expect = 0.81, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 36 KRFVSSLLFRLRRICNHSLLMQGRYTSEQKDRMAR 70 KR +S+ + R+I NH LL++ Y+ E R+AR Sbjct 500 KRQISNYFTQFRKIANHPLLIRRIYSDEDVIRIAR 534 > CE16277 Length=1038 Score = 30.4 bits (67), Expect = 0.85, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 43 LFRLRRICNHSLLMQGRYTSEQKDRMAR 70 L RLR+ NH LL + YT ++ D++A+ Sbjct 673 LMRLRQAANHPLLRRSEYTDQKLDKIAK 700 > SPCC1235.05c Length=1284 Score = 30.0 bits (66), Expect = 0.97, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query 10 AAQKGDTGSSGQQANEGDSREPEAGGKRFVSS-LLFRLRRICNHSLLMQGRYTSEQKDRM 68 A QK + N+ + E+ GK + +L +LR+ NH+LL + Y E+ +M Sbjct 811 ALQKNQQLRRDDKRNKRSKNDEESDGKSLSAGHVLMQLRKAANHALLFRKFYDDEKLKQM 870 Query 69 AR 70 A+ Sbjct 871 AK 872 > At3g31920 Length=725 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 0/24 (0%) Query 9 TAAQKGDTGSSGQQANEGDSREPE 32 TA GD S Q NE DS+EPE Sbjct 103 TAYFDGDVHSDSQNQNEDDSKEPE 126 > At1g61140 Length=1287 Score = 28.1 bits (61), Expect = 3.7, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 42 LLFRLRRICNHSLLMQGRYT 61 +L RLR+ C+H LL+ G Y+ Sbjct 951 MLLRLRQACDHPLLVNGEYS 970 > Hs15805014 Length=3124 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 39 VSSLLFRLRRICNHSLLMQGRY 60 V S+L RL+RICNH L++ R+ Sbjct 1321 VLSILVRLQRICNHPGLVEPRH 1342 > At3g12810 Length=1048 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%), Gaps = 0/19 (0%) Query 41 SLLFRLRRICNHSLLMQGR 59 S++ +LR++CNH L +GR Sbjct 395 SIIMQLRKVCNHPDLFEGR 413 > 7298963 Length=1061 Score = 27.7 bits (60), Expect = 5.0, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Query 33 AGGKRFVSS-----LLFRLRRICNHSLLMQGRYTSEQKDRMARH 71 AG K+ V S LL RLR+IC H L+ E+ M H Sbjct 777 AGSKKEVKSHDILVLLLRLRQICCHPGLIDAMLDGEESQTMGDH 820 Lambda K H 0.314 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1167934574 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40