bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5418_orf4 Length=60 Score E Sequences producing significant alignments: (Bits) Value 7296005 35.8 0.021 CE27691 35.0 0.032 Hs22055158 32.7 0.15 At1g24706 32.7 0.19 > 7296005 Length=1638 Score = 35.8 bits (81), Expect = 0.021, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 0/34 (0%) Query 23 DGMSVKFVLLFWRLSLEDILVPTEQYEASISKLQ 56 + +S +F++ FW LS+ D+ VP E Y+ ++KL+ Sbjct 939 EDISPQFLVTFWSLSMYDLHVPNESYQREVAKLK 972 > CE27691 Length=1437 Score = 35.0 bits (79), Expect = 0.032, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query 2 ENWGECMLPLLKPSGIDPQKLDGMSVKFVLLFWRLSLEDILVPTEQYEASISKLQN 57 E+ E ++ LK S +P + + VKF +FW L++ DI VPT YE ++ L+ Sbjct 844 ESQVEMLMDELKAS--EPGMEENIPVKFFAVFWMLTMYDIEVPTAAYERTLDALKK 897 > Hs22055158 Length=1514 Score = 32.7 bits (73), Expect = 0.15, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 23 DGMSVKFVLLFWRLSLEDILVPTEQYEASISKLQ 56 D +S +F FW L++ D+ VP YE ++KL+ Sbjct 795 DDISPQFYATFWSLTMYDLAVPHTSYEREVNKLK 828 > At1g24706 Length=1705 Score = 32.7 bits (73), Expect = 0.19, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 23 DGMSVKFVLLFWRLSLEDILVPTEQYEASISKLQNAL 59 + +S FW L+L D+ VP +YE+ ISK AL Sbjct 817 NSLSPDLYATFWGLTLYDLHVPRNRYESEISKQHTAL 853 Lambda K H 0.318 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181901402 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40