bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5341_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value CE28786 42.4 2e-04 Hs8922905 40.4 7e-04 7301306 37.0 0.009 SPBC1703.05 33.5 0.11 At3g51270 30.8 0.55 SPBC1703.04 30.8 0.72 Hs17488936 30.0 1.1 Hs4504741 30.0 1.2 Hs22042022 28.5 3.3 YNL207w 28.1 4.5 CE23841 27.7 4.7 > CE28786 Length=562 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 11/60 (18%) Query 1 YFDRDVQCIKRLFERKFLVEVTTVPKFDEV-----------VEGRETKLSSAADGALDEG 49 YFDRDV C++ F+RKF E PKFDEV G K++ + A DEG Sbjct 294 YFDRDVTCVRTFFKRKFDYESEDWPKFDEVERKGNMDVLLEASGFTKKMALDLNKAYDEG 353 > Hs8922905 Length=552 Score = 40.4 bits (93), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 15/109 (13%) Query 1 YFDRDVQCIKRLFERKFLVEVTTVPKFDEVVEGRETKLSSAADGALDEGRAE-------G 53 YFDRDV+CIK F ++F E P F ++ + +A G E +A+ G Sbjct 261 YFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLG 320 Query 54 AADG--EESSCNLISVSDDLDEHQAELLEGALAARQNNETESSCSDESE 100 D E + S SD E+ E A R NE+E +C +ESE Sbjct 321 PDDKNIETKEGSEFSFSD------GEVAEKAEVYRSENESERNCLEESE 363 > 7301306 Length=538 Score = 37.0 bits (84), Expect = 0.009, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 1 YFDRDVQCIKRLFERKFLVEVTTVPKFDEVV 31 +F+RDV C++ +F RKF E PKF ++V Sbjct 261 FFERDVNCVREMFRRKFGYESEDYPKFSDLV 291 > SPBC1703.05 Length=336 Score = 33.5 bits (75), Expect = 0.11, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query 1 YFDRDVQCIKRLFERKFLVEVTTVPKFDEV 30 YFDRDVQCI + FE+ + + VP F+++ Sbjct 253 YFDRDVQCIVQYFEKNYQYK-GDVPNFEDI 281 > At3g51270 Length=472 Score = 30.8 bits (68), Expect = 0.55, Method: Compositional matrix adjust. Identities = 9/17 (52%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 1 YFDRDVQCIKRLFERKF 17 YFDRD++CI + F ++F Sbjct 270 YFDRDIECIFKFFRKRF 286 > SPBC1703.04 Length=684 Score = 30.8 bits (68), Expect = 0.72, Method: Compositional matrix adjust. Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 2 FDRDVQCIKRLFERKFLVEVTTVPKFDEVVE 32 F R V C K++FE K + ++T++P+ V E Sbjct 652 FRRRVICPKKVFEEKCIYQITSLPRLYNVFE 682 > Hs17488936 Length=1167 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query 32 EGRETKLSSAADGALDEGRAEGAADGEESSCNLISVSDDLDEHQAELLEGALAA 85 EGRETK + A A EG ++ G + L+ V D + H E L AL A Sbjct 239 EGRETKTAQAIMVACTEGFSQSHG-GRPEAARLLVVVTDGESHDGEELPAALKA 291 > Hs4504741 Length=1167 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query 32 EGRETKLSSAADGALDEGRAEGAADGEESSCNLISVSDDLDEHQAELLEGALAA 85 EGRETK + A A EG ++ G + L+ V D + H E L AL A Sbjct 239 EGRETKTAQAIMVACTEGFSQSHG-GRPEAARLLVVVTDGESHDGEELPAALKA 291 > Hs22042022 Length=330 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Query 17 FLVEVTTVPKFDEVVEGRETKLSSAADGALDEGRAEGA 54 FL VPK GRE +LSS A GA E A GA Sbjct 236 FLCNTLVVPK----ASGREQELSSPASGASPEAPAAGA 269 > YNL207w Length=425 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%) Query 1 YFDRDVQCIKRLFERKFLVE 20 YF RDV CI+R F++K E Sbjct 268 YFQRDVDCIRRFFKKKLKYE 287 > CE23841 Length=476 Score = 27.7 bits (60), Expect = 4.7, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 72 DEHQAELLEGALAARQNNETESSCSDESETE 102 DE EL+EGA+ +NETE +ES+ E Sbjct 38 DEKLKELIEGAIPESTDNETELDDDEESDNE 68 Lambda K H 0.305 0.124 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174970866 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40