bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5288_orf1 Length=187 Score E Sequences producing significant alignments: (Bits) Value At4g00690 39.7 0.003 At3g06910 38.1 0.011 At1g10570 34.3 0.14 SPBC19G7.09 34.3 0.17 At5g60190 33.1 0.31 CE01521 31.6 0.87 SPBP19A11.07c 31.2 1.2 CE20145 30.4 1.9 At1g09730 30.4 1.9 YPL020c 30.4 2.3 CE17156 30.0 2.7 Hs22045248 30.0 3.1 Hs11055994_2 29.6 3.5 7293560 29.6 3.9 SPBC17D11.01 29.6 4.1 Hs20534876 29.3 4.4 Hs7657550 28.9 5.9 At3g26240 28.1 9.4 > At4g00690 Length=233 Score = 39.7 bits (91), Expect = 0.003, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 0/33 (0%) Query 34 GVSCTLHTPRQQNGYDCGVFVVEYVYFLTRNLN 66 G+ P+QQNGYDCG+F+++Y+ F +R L+ Sbjct 169 GMEYVEERPQQQNGYDCGMFMLKYIDFYSRGLS 201 > At3g06910 Length=478 Score = 38.1 bits (87), Expect = 0.011, Method: Compositional matrix adjust. Identities = 13/25 (52%), Positives = 21/25 (84%), Gaps = 0/25 (0%) Query 42 PRQQNGYDCGVFVVEYVYFLTRNLN 66 P Q+NG+DCG+F+V+Y+ F +R L+ Sbjct 429 PMQRNGFDCGMFMVKYIDFYSRGLD 453 > At1g10570 Length=566 Score = 34.3 bits (77), Expect = 0.14, Method: Composition-based stats. Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 16/94 (17%) Query 1 KRFLRHEFEHRCGGEMNCGQEVELCTESCCWHD--GVSCTLHTPRQQNGYDCGVFVVEYV 58 KRFLR E+ + +N ++L + W D + P+Q+N +DCG+F+ + Sbjct 461 KRFLREEWNY-----LNQDAPLDLPISAKVWRDLPNMINEAEVPQQKNDFDCGLFL---L 512 Query 59 YFLTRNLN------AIETLLLGPSRDFQPQQRSS 86 +F+ R + ++ L + + F+P++ S+ Sbjct 513 FFIRRFIEEAPQRLTLQDLKMIHKKWFKPEEASA 546 > SPBC19G7.09 Length=568 Score = 34.3 bits (77), Expect = 0.17, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 0/26 (0%) Query 40 HTPRQQNGYDCGVFVVEYVYFLTRNL 65 ++PRQ+NG+DCGVF + ++RN+ Sbjct 517 NSPRQRNGHDCGVFACKTAECVSRNV 542 > At5g60190 Length=226 Score = 33.1 bits (74), Expect = 0.31, Method: Compositional matrix adjust. Identities = 13/19 (68%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Query 37 CTLHTPRQQNGYDCGVFVV 55 CT TP+Q+NGYDCGVF++ Sbjct 154 CT-DTPQQKNGYDCGVFLL 171 > CE01521 Length=342 Score = 31.6 bits (70), Expect = 0.87, Method: Compositional matrix adjust. Identities = 19/80 (23%), Positives = 31/80 (38%), Gaps = 27/80 (33%) Query 1 KRFLRHEFEHRCGGEMNCGQEVELCTESCCWHDGVSCTL--HTPRQQNGYDCGVFVVEYV 58 + F+++ +E R G M + C L P+Q N +DCG+F+ E+ Sbjct 273 ESFMKYSYEKRTGNAMPFP---------------LPCILPQRMPQQTNNFDCGIFIAEFA 317 Query 59 YFLTRNLNAIETLLLGPSRD 78 LL P +D Sbjct 318 ----------RRFLLSPPKD 327 > SPBP19A11.07c Length=676 Score = 31.2 bits (69), Expect = 1.2, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query 44 QQNGYDCGVFVVEYVYFLTRNLN---AIETLLLGPSRDFQP 81 QQN DC + ++YFL N N I LL R F+P Sbjct 490 QQNASDCKKLLSSFLYFLINNFNDNLHIIELLQKDKRKFEP 530 > CE20145 Length=1297 Score = 30.4 bits (67), Expect = 1.9, Method: Compositional matrix adjust. Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 9/68 (13%) Query 41 TPRQQN----GYDCGVFVVEYVYFLTRNLNAIETLLLGPSRDF-----QPQQRSSRDQTP 91 TP QN G+ C + +YF R++ I+ L G + +P+ S Q P Sbjct 742 TPNSQNSCPLGFQCTYSSIRMLYFCCRDIVRIDKCLQGSRPEIWQSTAEPRACSRDAQCP 801 Query 92 DSTASFVP 99 +T+ + P Sbjct 802 STTSCYAP 809 > At1g09730 Length=865 Score = 30.4 bits (67), Expect = 1.9, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 38 TLHTPRQQNGYDCGVFVVEYV 58 +L P+Q+N +DCG+F++ Y+ Sbjct 499 SLELPQQENSFDCGLFLLHYL 519 > YPL020c Length=621 Score = 30.4 bits (67), Expect = 2.3, Method: Composition-based stats. Identities = 10/16 (62%), Positives = 13/16 (81%), Gaps = 0/16 (0%) Query 39 LHTPRQQNGYDCGVFV 54 L P+Q NGYDCG++V Sbjct 569 LDCPQQPNGYDCGIYV 584 > CE17156 Length=311 Score = 30.0 bits (66), Expect = 2.7, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 42 PRQQNGYDCGVFVVEYVYFLTRNLNAIETL 71 P+Q+N DCG+F++ + + T+ A ++L Sbjct 246 PQQKNSVDCGIFMMAFAEYFTKYNTAWQSL 275 > Hs22045248 Length=144 Score = 30.0 bits (66), Expect = 3.1, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query 31 WHDGVSCTLHTPRQQNGYDCGVFVVEY 57 W V T P+Q+N DCGVFV++Y Sbjct 85 WQTAV--TKCIPQQKNDSDCGVFVLQY 109 > Hs11055994_2 Length=247 Score = 29.6 bits (65), Expect = 3.5, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 42 PRQQNGYDCGVFVVEYVYFLTRN 64 P+Q NG DCG+F +Y +++R+ Sbjct 198 PQQLNGSDCGMFTCKYADYISRD 220 > 7293560 Length=1513 Score = 29.6 bits (65), Expect = 3.9, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 0/24 (0%) Query 42 PRQQNGYDCGVFVVEYVYFLTRNL 65 PRQ N DCGVF + ++TR++ Sbjct 1463 PRQGNSSDCGVFSCMFAEYITRDV 1486 > SPBC17D11.01 Length=281 Score = 29.6 bits (65), Expect = 4.1, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Query 43 RQQNGYDCGVFVVEYVYFLTRNL--NAIETLLLGPSRDFQPQQRSSRDQ 89 +Q+NGYDCG V + L R L + + T + FQP + R+Q Sbjct 160 QQRNGYDCGAHVCAFTLELVRRLLHSPMPTSSMWNLSTFQPDVTAIREQ 208 > Hs20534876 Length=170 Score = 29.3 bits (64), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 17/24 (70%), Gaps = 0/24 (0%) Query 41 TPRQQNGYDCGVFVVEYVYFLTRN 64 P+Q NG DCG+F +Y +++R+ Sbjct 120 IPQQLNGSDCGMFTCKYADYISRD 143 > Hs7657550 Length=643 Score = 28.9 bits (63), Expect = 5.9, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 42 PRQQNGYDCGVFVVEYVYFLTRN 64 P+Q NG DCG+F +Y +T++ Sbjct 594 PQQMNGSDCGMFACKYADCITKD 616 > At3g26240 Length=922 Score = 28.1 bits (61), Expect = 9.4, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Query 12 CGGEMNCGQEVELCTESCCWHDGVSCTLH-----TPRQQNGYDCGVFVV 55 C G++N + C E CC H ++C L PR CG ++ Sbjct 808 CEGKINPEEGFYRCDEYCCVHLHITCLLGKDLYLKPRSSWSLSCGALLI 856 Lambda K H 0.321 0.134 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3058524910 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40