bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5266_orf3 Length=52 Score E Sequences producing significant alignments: (Bits) Value At3g02530 51.2 4e-07 Hs4502643 48.5 3e-06 YDR188w 48.1 4e-06 At5g16070 48.1 4e-06 7293119 45.8 2e-05 Hs5729761 43.1 1e-04 Hs14771918 43.1 1e-04 SPBC646.11 42.4 2e-04 CE01234 42.0 3e-04 Hs20538837 39.7 0.001 Hs20540233 35.0 0.032 CE02985 34.3 0.061 CE28255 33.5 0.092 YJL111w 31.2 0.54 7299092 30.0 1.0 Hs5453605 30.0 1.2 7303510 29.6 1.3 CE18867 28.1 4.4 CE18866 28.1 4.5 SPAC1420.02c 27.7 5.7 Hs16159222 26.9 9.6 > At3g02530 Length=535 Score = 51.2 bits (121), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR+L GF+ A++ TLQ LD K V + PD+E+L VART Sbjct 111 EGMHPRVLVDGFEIAKRATLQFLDTFKTPVVMGDEPDKEILKMVART 157 > Hs4502643 Length=531 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 4/47 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR++ GF+ A++K LQ L+EVKV + DRE L+ VART Sbjct 112 EGLHPRIITEGFEAAKEKALQFLEEVKVSREM----DRETLIDVART 154 > YDR188w Length=546 Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EGVHPR++ GF+ AR+++++ LDE K+ DRE LL VAR+ Sbjct 111 EGVHPRIITDGFEIARKESMKFLDEFKIS-KTNLSNDREFLLQVARS 156 > At5g16070 Length=540 Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR+L GF+ A++ TLQ LD K V + D+E+L VART Sbjct 116 EGMHPRVLVDGFEIAKRATLQFLDNFKTPVVMGDEVDKEILKMVART 162 > 7293119 Length=533 Score = 45.8 bits (107), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR++ GF+KAR K L++LD+VKV V + +++ L+ VA T Sbjct 112 EGLHPRIMTDGFEKARDKALEVLDQVKVPVEI----NKKNLVEVANT 154 > Hs5729761 Length=540 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR++ GF+ A+ K L++L+EVKV ++ R++LL VART Sbjct 111 EGLHPRIIAEGFEAAKIKALEVLEEVKVTKEMK----RKILLDVART 153 > Hs14771918 Length=530 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR++ GF+ A+ K L++L+EVKV ++ R++LL VART Sbjct 112 EGLHPRIIAEGFEAAKIKALEVLEEVKVTKEMK----RKILLDVART 154 > SPBC646.11 Length=535 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HP L+ GF+ A+ + L LD K V DRE+LL+VA+T Sbjct 110 EGLHPSLISDGFNLAKNEALTFLDSFKTDFEV----DREVLLNVAKT 152 > CE01234 Length=539 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+HPR++ GF+ A KTL+LL++ K + VE R+LL+ V RT Sbjct 112 EGLHPRIVTEGFEWANTKTLELLEKFKKEAPVE----RDLLVEVCRT 154 > Hs20538837 Length=190 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVAR 46 EG+HPR++ GF+ ++K L L+EVKV + D+E L VAR Sbjct 110 EGLHPRIITEGFEAVKEKALHFLEEVKVSREM----DKETLKDVAR 151 > Hs20540233 Length=323 Score = 35.0 bits (79), Expect = 0.032, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 4/41 (9%) Query 7 LLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 ++ GF+ A++K L+ L+EVK++ DRE L++VART Sbjct 63 IITEGFEAAKEKALRFLEEVKIR----KEMDRETLINVART 99 > CE02985 Length=542 Score = 34.3 bits (77), Expect = 0.061, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query 2 GVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 G+HP + GFD A +K L+ LD + K VE +RE L+ A+T Sbjct 128 GIHPIKIADGFDLACKKALETLDSISDKFPVE---NRERLVETAQT 170 > CE28255 Length=535 Score = 33.5 bits (75), Expect = 0.092, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVARTLS 49 +GVHP+LL KA +KTL+ L ++++K+ E L+ A TLS Sbjct 114 DGVHPQLLIRAIGKACEKTLKNLADLEIKINGETELREMLVKCAATTLS 162 > YJL111w Length=550 Score = 31.2 bits (69), Expect = 0.54, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 EG+ L+ G+ KA ++ ++E+ V + E RELL ART Sbjct 118 EGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCART 164 > 7299092 Length=501 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 0/42 (0%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLL 42 EGVHPR++ KA Q ++ ++E+ V++ + + + LL Sbjct 70 EGVHPRVIIKAIRKALQLCMEKINEMAVQIVEQSKDQQRALL 111 > Hs5453605 Length=539 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 +G+HP ++ F KA +K +++L ++ V + DRE LL+ A T Sbjct 126 KGIHPTIISESFQKALEKGIEILTDMSRPVELS---DRETLLNSATT 169 > 7303510 Length=542 Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query 2 GVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 G+HP + GF+ A Q ++ LD + V+P+ ++E L+ +A T Sbjct 128 GIHPIRIADGFELAAQCAIKQLDAIAQPFPVDPK-NKEPLIQIAMT 172 > CE18867 Length=785 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 0/46 (0%) Query 5 PRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVARTLSV 50 P++L + F A +K+L D VKV+ AV E S A T+S+ Sbjct 698 PKILRSSFSGAIRKSLSTPDSVKVETAVTVTALFEFAKSSAETMSI 743 > CE18866 Length=783 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 0/46 (0%) Query 5 PRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVARTLSV 50 P++L + F A +K+L D VKV+ AV E S A T+S+ Sbjct 698 PKILRSSFSGAIRKSLSTPDSVKVETAVTVTALFEFAKSSAETMSI 743 > SPAC1420.02c Length=546 Score = 27.7 bits (60), Expect = 5.7, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 0/49 (0%) Query 1 EGVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVARTLS 49 +G+HP + G++KA Q ++ LD + V P L S +L Sbjct 128 KGIHPIRIADGYEKACQVAVKHLDAISDVVDFSPENTTNLFRSAKTSLG 176 > Hs16159222 Length=541 Score = 26.9 bits (58), Expect = 9.6, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query 2 GVHPRLLCAGFDKARQKTLQLLDEVKVKVAVEPRPDRELLLSVART 47 G+HP + G+++A + ++ LD++ V V+ + D E L+ A+T Sbjct 127 GIHPIRIADGYEQAARVAIEHLDKISDSVLVDIK-DTEPLIQTAKT 171 Lambda K H 0.320 0.137 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1158678716 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40