bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5262_orf1 Length=84 Score E Sequences producing significant alignments: (Bits) Value At1g73720 64.3 6e-11 7300458 58.2 4e-09 Hs8922679 54.7 4e-08 YCR057c 43.1 1e-04 CE15742 43.1 1e-04 SPBC713.04c 40.8 6e-04 YIL046w 39.7 0.001 YMR146c 38.9 0.003 Hs16117781 36.6 0.011 Hs4826956 36.6 0.011 Hs16117779 36.6 0.011 At2g46280 36.6 0.012 At2g46290 36.2 0.014 CE11192 35.8 0.020 Hs19705568 35.8 0.023 7297395 35.4 0.023 Hs4557491 35.4 0.024 CE28600 35.4 0.024 At4g02730 35.4 0.025 7303631 35.0 0.032 At5g16750 34.3 0.059 7292465 33.9 0.071 YGL137w 33.9 0.072 7300370 33.9 0.077 Hs16306498 33.5 0.089 Hs22047819 33.5 0.092 Hs16117783 33.5 0.095 Hs16306496 33.5 0.097 YLR129w 33.5 0.099 Hs4502477 33.5 0.099 Hs16306494 33.5 0.10 Hs21071067 33.5 0.11 Hs21071065 33.5 0.11 SPBC1711.16 33.1 0.11 At3g49660 33.1 0.12 SPAC18B11.10 33.1 0.12 Hs20357529 33.1 0.12 At1g15440 33.1 0.13 Hs13994164_1 33.1 0.13 Hs18874090 33.1 0.13 ECU08g1110 33.1 0.13 SPAC57A10.05c 33.1 0.14 Hs5453581 32.7 0.15 Hs4557741 32.7 0.16 7301804 32.7 0.17 Hs4504053 32.7 0.18 CE26171 32.7 0.19 Hs18544419 32.3 0.20 At3g18140 32.3 0.20 Hs9506645 32.3 0.21 > At1g73720 Length=522 Score = 64.3 bits (155), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 6/83 (7%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDLF 61 D +RIIT S+D +K+WD+KT DCL TF PP PP + SV SI L P+N + Sbjct 369 DGSRIITASSDCTVKVWDSKTTDCLQTFKPP-PPLRGTD---ASVNSIHLFPKNT--EHI 422 Query 62 YVCTKSNTISLMNYSGKTINSWS 84 VC K+++I +M G+ + S+S Sbjct 423 VVCNKTSSIYIMTLQGQVVKSFS 445 Score = 31.2 bits (69), Expect = 0.48, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D+ + +GS DGKIK+W +T C+ F Sbjct 285 DSEMLASGSQDGKIKIWRIRTGVCIRRF 312 > 7300458 Length=486 Score = 58.2 bits (139), Expect = 4e-09, Method: Composition-based stats. Identities = 27/84 (32%), Positives = 51/84 (60%), Gaps = 10/84 (11%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDL 60 PD +++ S+DG +K+W KT +C++T+ P + E +V ++++ P+N + Sbjct 336 PDGHSVLSASSDGTVKVWSLKTTECVATYKP-----LGNEL---AVNTVLILPKNP--EH 385 Query 61 FYVCTKSNTISLMNYSGKTINSWS 84 F VC +SNT+ +MN G+ + S+S Sbjct 386 FIVCNRSNTVVIMNMQGQIVRSFS 409 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 D+ + +G+ DG+IK+W T CL F H + CL Sbjct 252 DSEMVASGAQDGQIKVWRIITGQCLRKFE---KAHTKGITCL 290 Score = 27.3 bits (59), Expect = 6.3, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 1 PDNTRIITGSADGKIKLWDAKT 22 PD +ITGS DG +++W+ T Sbjct 201 PDGQYLITGSVDGFLEVWNFTT 222 > Hs8922679 Length=513 Score = 54.7 bits (130), Expect = 4e-08, Method: Composition-based stats. Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 6/83 (7%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDLF 61 D II+ S+DG +K+W+ KT +C +TF +V S+IL P+N + F Sbjct 360 DGHYIISASSDGTVKIWNMKTTECSNTFK----SLGSTAGTDITVNSVILLPKNP--EHF 413 Query 62 YVCTKSNTISLMNYSGKTINSWS 84 VC +SNT+ +MN G+ + S+S Sbjct 414 VVCNRSNTVVIMNMQGQIVRSFS 436 Score = 31.6 bits (70), Expect = 0.39, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 D + TG+ DGKIK+W ++ CL F H + CL Sbjct 275 DTEMLATGAQDGKIKVWKIQSGQCLRRFE---RAHSKGVTCL 313 Score = 27.7 bits (60), Expect = 5.7, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 1 PDNTRIITGSADGKIKLWDAKT 22 PD ++TGS DG I++W+ T Sbjct 224 PDGQYLVTGSVDGFIEVWNFTT 245 > YCR057c Length=923 Score = 43.1 bits (100), Expect = 1e-04, Method: Composition-based stats. Identities = 16/29 (55%), Positives = 22/29 (75%), Gaps = 0/29 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTF 29 PD +R++T S DGKIK+WD + CL+TF Sbjct 355 PDGSRVVTASEDGKIKVWDITSGFCLATF 383 > CE15742 Length=510 Score = 43.1 bits (100), Expect = 1e-04, Method: Composition-based stats. Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 9/81 (11%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDLF 61 + II+ S DG I++W K+ +CLSTF + P ++++I P++ + Sbjct 360 EGNHIISCSTDGSIRVWHGKSGECLSTFR-------VGSEDYP-ILNVIPIPKSDPPQMI 411 Query 62 YVCTKSNTISLMNYSGKTINS 82 VC +SNT+ ++N SG+ + + Sbjct 412 -VCNRSNTLYVVNISGQVVRT 431 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D+ + TGS DGKIK+W +T DCL F Sbjct 275 DSEMLATGSIDGKIKVWKVETGDCLRRF 302 > SPBC713.04c Length=854 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D RIITG+ DGKIK+WD + C+ TFT Sbjct 350 DGQRIITGADDGKIKVWDMNSGFCIVTFT 378 > YIL046w Length=640 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 DN RII+GS DG IK+WD ++ C+ TF Sbjct 561 DNFRIISGSHDGSIKVWDLQSGKCMHTF 588 Score = 32.0 bits (71), Expect = 0.32, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D+ ++ITGS D I++W+ T +C+ST+ Sbjct 351 DDRKLITGSLDKTIRVWNYITGECISTY 378 Score = 26.9 bits (58), Expect = 9.1, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 4 TRIITGSADGKIKLWDAKTQDCLST 28 T +++ D IKLWD KT C+ T Sbjct 523 THLLSCGLDNTIKLWDVKTGKCIRT 547 > YMR146c Length=347 Score = 38.9 bits (89), Expect = 0.003, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 7 ITGSADGKIKLWDAKTQDCLSTFTPPVP 34 +TGSAD IKLWD C++T+ PVP Sbjct 68 VTGSADYSIKLWDVSNGQCVATWKSPVP 95 > Hs16117781 Length=707 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query 6 IITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 +++G+AD +K+WD KT CL T P H A CL Sbjct 594 LVSGNADSTVKIWDIKTGQCLQTLQGP-NKHQSAVTCL 630 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D +++GS D I++WD +T +C+ T T Sbjct 550 DGIHVVSGSLDTSIRVWDVETGNCIHTLT 578 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D R+++G+ D +K+WD +T+ CL T Sbjct 510 DGRRVVSGAYDFMVKVWDPETETCLHTL 537 Score = 30.4 bits (67), Expect = 0.80, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 6 IITGSADGKIKLWDAKTQDCLSTF 29 II+GS D +K+W+A+T +C+ T Sbjct 434 IISGSTDRTLKVWNAETGECIHTL 457 Score = 30.4 bits (67), Expect = 0.84, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 5 RIITGSADGKIKLWDAKTQDCLSTF 29 RI++GS D +K+W A T CL T Sbjct 393 RIVSGSDDNTLKVWSAVTGKCLRTL 417 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Query 5 RIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 R+++GS D +++WD +T CL H+ A +C+ Sbjct 473 RVVSGSRDATLRVWDIETGQCLHVLM----GHVAAVRCV 507 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 6 IITGSADGKIKLWDAKT 22 +IT S DG +KLWD KT Sbjct 637 VITSSDDGTVKLWDLKT 653 > Hs4826956 Length=919 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 PD I+TG DGK+K+W+ + C TFT Sbjct 383 PDGQYIVTGGDDGKVKVWNTLSGFCFVTFT 412 > Hs16117779 Length=627 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query 6 IITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 +++G+AD +K+WD KT CL T P H A CL Sbjct 514 LVSGNADSTVKIWDIKTGQCLQTLQGP-NKHQSAVTCL 550 Score = 33.1 bits (74), Expect = 0.15, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D +++GS D I++WD +T +C+ T T Sbjct 470 DGIHVVSGSLDTSIRVWDVETGNCIHTLT 498 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D R+++G+ D +K+WD +T+ CL T Sbjct 430 DGRRVVSGAYDFMVKVWDPETETCLHTL 457 Score = 30.4 bits (67), Expect = 0.82, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 6 IITGSADGKIKLWDAKTQDCLSTF 29 II+GS D +K+W+A+T +C+ T Sbjct 354 IISGSTDRTLKVWNAETGECIHTL 377 Score = 30.4 bits (67), Expect = 0.86, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 5 RIITGSADGKIKLWDAKTQDCLSTF 29 RI++GS D +K+W A T CL T Sbjct 313 RIVSGSDDNTLKVWSAVTGKCLRTL 337 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Query 5 RIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 R+++GS D +++WD +T CL H+ A +C+ Sbjct 393 RVVSGSRDATLRVWDIETGQCLHVLM----GHVAAVRCV 427 Score = 28.5 bits (62), Expect = 3.4, Method: Composition-based stats. Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 6 IITGSADGKIKLWDAKT 22 +IT S DG +KLWD KT Sbjct 557 VITSSDDGTVKLWDLKT 573 > At2g46280 Length=328 Score = 36.6 bits (83), Expect = 0.012, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVP 34 D++R+ITGSAD KLWD K+ L TF P Sbjct 63 DSSRLITGSADQTAKLWDVKSGKELFTFKFNAP 95 > At2g46290 Length=328 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVP 34 D++R+ITGSAD KLWD K+ L TF P Sbjct 63 DSSRLITGSADQTAKLWDVKSGKELFTFKFGAP 95 Score = 34.3 bits (77), Expect = 0.055, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVP 34 D++ +TGS D KLWD +T + T+T VP Sbjct 204 DDSHFLTGSHDKTAKLWDMRTLTLIKTYTTVVP 236 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCL 26 P N I++G D I++WDA+T L Sbjct 158 PLNQTIVSGGEDAAIRIWDAETGKLL 183 > CE11192 Length=925 Score = 35.8 bits (81), Expect = 0.020, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTF 29 PD + + TG+ DGK+K+W++++ C TF Sbjct 370 PDGSLMATGAEDGKVKIWNSRSSFCTVTF 398 > Hs19705568 Length=293 Score = 35.8 bits (81), Expect = 0.023, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 0/27 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLST 28 DN RI++GS D +KLWD +++ C+ T Sbjct 78 DNARIVSGSHDRTLKLWDLRSKVCIKT 104 > 7297395 Length=317 Score = 35.4 bits (80), Expect = 0.023, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 0/58 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGM 58 PD+ I +GS DG++ +W+A T + +S P +Q Q P M + A N+ Sbjct 251 PDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGPVQCVQFNPKYMMLASACTNMAF 308 > Hs4557491 Length=431 Score = 35.4 bits (80), Expect = 0.024, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Query 7 ITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQC 42 +TGS DG IKLWD + C++TF H AE C Sbjct 278 VTGSKDGCIKLWDGVSNRCITTFE---KAHDGAEVC 310 > CE28600 Length=665 Score = 35.4 bits (80), Expect = 0.024, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 DN II+GS+D +++WD +T +C+ T Sbjct 271 DNRVIISGSSDATVRVWDVETGECIKTL 298 Score = 32.0 bits (71), Expect = 0.28, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 8/46 (17%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVM 47 D RI++G+ DGKIK+WD Q L P + +E CL S++ Sbjct 434 DEKRIVSGAYDGKIKVWD--LQAALD------PRALSSEICLCSLV 471 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDC 25 D+ +I++G D IK+WD K C Sbjct 231 DDDKIVSGLRDNTIKIWDRKDYSC 254 > At4g02730 Length=333 Score = 35.4 bits (80), Expect = 0.025, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 0/59 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDL 60 D + I++ S DG K+WDAK CL T P + + P+ I++A + + L Sbjct 181 DGSLIVSASHDGSCKIWDAKEGTCLKTLIDDKSPAVSFAKFSPNGKFILVATLDSTLKL 239 Score = 26.9 bits (58), Expect = 9.2, Method: Compositional matrix adjust. Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCL 26 P + I++GS D I++W+ KT C+ Sbjct 138 PPSNLIVSGSFDETIRIWEVKTGKCV 163 > 7303631 Length=680 Score = 35.0 bits (79), Expect = 0.032, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMS 48 PD ++++GS+DG IK+W+ Q C+ T H+ E +MS Sbjct 218 PDGNQVVSGSSDGTIKVWNLGQQRCVQTI------HVHKEGVWSLLMS 259 > At5g16750 Length=876 Score = 34.3 bits (77), Expect = 0.059, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D T+ ++ ADG +KLW+ T +C++T+ Sbjct 594 DGTQFVSCGADGLLKLWNVNTSECIATY 621 Score = 31.6 bits (70), Expect = 0.41, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 3 NTRIITGSADGKIKLWDAKTQDCLSTFT 30 N I+TGS D ++LW+A ++ C+ T Sbjct 416 NVLIVTGSKDKTVRLWNATSKSCIGVGT 443 > 7292465 Length=1326 Score = 33.9 bits (76), Expect = 0.071, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query 6 IITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 +++G+AD +K+WD T CL T + P H A CL Sbjct 1208 LVSGNADSTVKVWDITTGQCLQTLSGP-NKHHSAVTCL 1244 Score = 29.6 bits (65), Expect = 1.3, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Query 3 NTR-IITGSADGKIKLWDAKTQD 24 N+R ++T S DG +KLWD KT D Sbjct 1247 NSRFVVTSSDDGTVKLWDVKTGD 1269 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D +++GS D I++WD +T +C T Sbjct 1164 DGLHVVSGSLDTSIRVWDVETGNCKHTL 1191 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 11/49 (22%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query 4 TRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILA 52 +++++GS D +++WD + CL H+ A +C+ +I++ Sbjct 1086 SKVVSGSRDATLRVWDIEQGSCLHVLV----GHLAAVRCVQYDGKLIVS 1130 Score = 28.1 bits (61), Expect = 4.3, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 5 RIITGSADGKIKLWDAKTQDCLSTF 29 RI++GS D +K+W A CL T Sbjct 1007 RIVSGSDDNTLKVWSAVNGKCLRTL 1031 Score = 27.3 bits (59), Expect = 7.4, Method: Compositional matrix adjust. Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D I++G+ D +K+W + Q+CL T Sbjct 1124 DGKLIVSGAYDYMVKIWHPERQECLHTL 1151 > YGL137w Length=889 Score = 33.9 bits (76), Expect = 0.072, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTF 29 PD +IT S D IK+WD +T+ C++T Sbjct 196 PDKPYMITASDDLTIKIWDYQTKSCVATL 224 > 7300370 Length=922 Score = 33.9 bits (76), Expect = 0.077, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 13/69 (18%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDLF 61 D+ I+TGSAD +K+W DC H SVMS+ PR +F Sbjct 592 DSNLIVTGSADRNVKVWGLNFGDC----------HRSIFAHDDSVMSVQFIPRT---HMF 638 Query 62 YVCTKSNTI 70 + C K + Sbjct 639 FTCGKDGKV 647 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLST 28 D + +++ S D +IK W+ +TQ C T Sbjct 166 DESIVVSCSKDTQIKFWNLETQFCFKT 192 > Hs16306498 Length=508 Score = 33.5 bits (75), Expect = 0.089, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 16/18 (88%), Gaps = 0/18 (0%) Query 2 DNTRIITGSADGKIKLWD 19 DN RI++G+ DGKIK+WD Sbjct 418 DNKRIVSGAYDGKIKVWD 435 Score = 32.3 bits (72), Expect = 0.22, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D+ +II+G D IK+WD + +CL T Sbjct 215 DDEKIISGLRDNSIKIWDKTSLECLKVLT 243 Score = 30.4 bits (67), Expect = 0.83, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D I+TGS+D +++WD T + L+T Sbjct 255 DERVIVTGSSDSTVRVWDVNTGEVLNTL 282 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 6 IITGSADGKIKLWDAKTQDCL 26 +++GS+D I+LWD + CL Sbjct 382 VVSGSSDNTIRLWDIECGACL 402 > Hs22047819 Length=880 Score = 33.5 bits (75), Expect = 0.092, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 0/57 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVG 57 PD R++TGS DG +LW C + P C +S AP + G Sbjct 122 PDGQRLLTGSEDGTARLWSTADGQCCALLQAHRPQTADPSSCARRPLSRSPAPAHPG 178 Score = 30.8 bits (68), Expect = 0.66, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 3 NTRIITGSADGKIKLWDAKTQDCLSTFT 30 N + +GSAD +K W A T +C+ TFT Sbjct 498 NRLVYSGSADRTVKCWLADTGECVRTFT 525 > Hs16117783 Length=605 Score = 33.5 bits (75), Expect = 0.095, Method: Compositional matrix adjust. Identities = 12/18 (66%), Positives = 16/18 (88%), Gaps = 0/18 (0%) Query 2 DNTRIITGSADGKIKLWD 19 DN RI++G+ DGKIK+WD Sbjct 515 DNKRIVSGAYDGKIKVWD 532 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D IITGS+D +++WD T + L+T Sbjct 352 DERVIITGSSDSTVRVWDVNTGEMLNTL 379 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D+ +I++G D IK+WD T +C T Sbjct 312 DDQKIVSGLRDNTIKIWDKNTLECKRILT 340 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Query 6 IITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCL 43 +++GS+D I+LWD + CL + H + +C+ Sbjct 479 VVSGSSDNTIRLWDIECGACLRV----LEGHEELVRCI 512 > Hs16306496 Length=529 Score = 33.5 bits (75), Expect = 0.097, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 16/18 (88%), Gaps = 0/18 (0%) Query 2 DNTRIITGSADGKIKLWD 19 DN RI++G+ DGKIK+WD Sbjct 439 DNKRIVSGAYDGKIKVWD 456 Score = 32.3 bits (72), Expect = 0.24, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D+ +II+G D IK+WD + +CL T Sbjct 236 DDEKIISGLRDNSIKIWDKTSLECLKVLT 264 Score = 30.4 bits (67), Expect = 0.92, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D I+TGS+D +++WD T + L+T Sbjct 276 DERVIVTGSSDSTVRVWDVNTGEVLNTL 303 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 6 IITGSADGKIKLWDAKTQDCL 26 +++GS+D I+LWD + CL Sbjct 403 VVSGSSDNTIRLWDIECGACL 423 > YLR129w Length=943 Score = 33.5 bits (75), Expect = 0.099, Method: Composition-based stats. Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 6 IITGSADGKIKLWDAKTQDCLST 28 +I+ S DG IKLWD KT C+ T Sbjct 177 LISTSKDGMIKLWDLKTHQCIET 199 Score = 32.7 bits (73), Expect = 0.15, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCL 26 D R++TGSAD +K WD K ++ L Sbjct 484 DGKRLVTGSADKTVKFWDFKVENSL 508 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 13/69 (18%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNVGMDLF 61 D+ IIT SAD IK+W DC + + A Q S+M++ P++ F Sbjct 584 DSKMIITSSADKNIKIWGLDFGDCHKS--------LFAHQ--DSIMNVKFLPQSHN---F 630 Query 62 YVCTKSNTI 70 + C+K + Sbjct 631 FSCSKDAVV 639 > Hs4502477 Length=569 Score = 33.5 bits (75), Expect = 0.099, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 16/18 (88%), Gaps = 0/18 (0%) Query 2 DNTRIITGSADGKIKLWD 19 DN RI++G+ DGKIK+WD Sbjct 479 DNKRIVSGAYDGKIKVWD 496 Score = 30.8 bits (68), Expect = 0.72, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D IITGS+D +++WD T + L+T Sbjct 316 DERVIITGSSDSTVRVWDVNTGEMLNTL 343 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D+ +I++G D IK+WD T +C T Sbjct 276 DDQKIVSGLRDNTIKIWDKNTLECKRILT 304 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 6 IITGSADGKIKLWDAKTQDCL 26 +++GS+D I+LWD + CL Sbjct 443 VVSGSSDNTIRLWDIECGACL 463 > Hs16306494 Length=542 Score = 33.5 bits (75), Expect = 0.10, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 16/18 (88%), Gaps = 0/18 (0%) Query 2 DNTRIITGSADGKIKLWD 19 DN RI++G+ DGKIK+WD Sbjct 452 DNKRIVSGAYDGKIKVWD 469 Score = 32.0 bits (71), Expect = 0.25, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D+ +II+G D IK+WD + +CL T Sbjct 249 DDEKIISGLRDNSIKIWDKTSLECLKVLT 277 Score = 30.0 bits (66), Expect = 0.99, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D I+TGS+D +++WD T + L+T Sbjct 289 DERVIVTGSSDSTVRVWDVNTGEVLNTL 316 Score = 27.3 bits (59), Expect = 7.4, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 6 IITGSADGKIKLWDAKTQDCL 26 +++GS+D I+LWD + CL Sbjct 416 VVSGSSDNTIRLWDIECGACL 436 > Hs21071067 Length=800 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 P++ + TGSAD ++LWD +C+ FT Sbjct 637 PNSNYVATGSADRTVRLWDVLNGNCVRIFT 666 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 0/26 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCL 26 PD +++ S DG ++LW +T CL Sbjct 553 PDRNYLLSSSEDGTVRLWSLQTFTCL 578 > Hs21071065 Length=745 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 P++ + TGSAD ++LWD +C+ FT Sbjct 582 PNSNYVATGSADRTVRLWDVLNGNCVRIFT 611 > SPBC1711.16 Length=516 Score = 33.1 bits (74), Expect = 0.11, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 6 IITGSADGKIKLWDAKTQDCLSTFT 30 +++GSAD +KLWD T +C+ +FT Sbjct 270 LVSGSADTTLKLWDLSTCNCVKSFT 294 > At3g49660 Length=317 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPSVMSIILAPRNV 56 P+ I+ G+ D ++LW+ + L T+T H+ A+ C+ S S+ R V Sbjct 208 PNGKFILVGTLDNTLRLWNISSAKFLKTYT----GHVNAQYCISSAFSVTNGKRIV 259 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPH 36 P + I++GS D +++WD T CL +P H Sbjct 123 PQSNMIVSGSFDETVRIWDVTTGKCLKV----LPAH 154 > SPAC18B11.10 Length=614 Score = 33.1 bits (74), Expect = 0.12, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 PD ++TG+ D +IKLWD TQ F+ Sbjct 370 PDGKYLVTGTEDRQIKLWDLSTQKVRYVFS 399 Score = 27.7 bits (60), Expect = 6.1, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 0/21 (0%) Query 6 IITGSADGKIKLWDAKTQDCL 26 I++GS D +LWD +T C+ Sbjct 417 IVSGSGDRTARLWDVETGQCI 437 > Hs20357529 Length=340 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 0/29 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTF 29 PD ++G+ D IKLWD + C TF Sbjct 194 PDGRTFVSGACDASIKLWDVRDSMCRQTF 222 > At1g15440 Length=900 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 PD+ + TG+ D K+K+W+ + C TFT Sbjct 399 PDSQLLATGADDNKVKVWNVMSGTCFITFT 428 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPPHMQAEQCLPS 45 DN +++ S DG ++ WD K T+T P P + PS Sbjct 442 DNHSLLSASLDGTVRAWDFKRYKNYKTYTTPTPRQFVSLTADPS 485 > Hs13994164_1 Length=756 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 5 RIITGSADGKIKLWDAKTQDCLSTFTPPVP 34 R+++G D ++K+WD T CL TF P Sbjct 507 RLVSGGRDCQVKVWDVDTGKCLKTFRHKDP 536 > Hs18874090 Length=677 Score = 33.1 bits (74), Expect = 0.13, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTF 29 D T+ ++GS+DG I+LW Q C++T+ Sbjct 221 DGTQCLSGSSDGTIRLWSLGQQRCIATY 248 > ECU08g1110 Length=334 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 6 IITGSADGKIKLWDAKTQDCLSTF 29 + +GSADG +K+WD TQ+ L T+ Sbjct 170 LASGSADGTVKIWDLDTQEHLQTY 193 > SPAC57A10.05c Length=605 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPP 35 D +++GS D IK+W +T CL TF+ + P Sbjct 403 DRGLVLSGSDDSTIKIWSLETNTCLHTFSAHIGP 436 Score = 30.8 bits (68), Expect = 0.59, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLS 27 D ++I+GS D I++W+ +T +C+S Sbjct 322 DQCKLISGSMDKTIRIWNYRTSECIS 347 Score = 27.3 bits (59), Expect = 6.7, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 3 NTRIITGSADGKIKLWDAKTQDCLSTF 29 ++R+ + S DG IK WD + + C+ T Sbjct 444 DSRLFSCSLDGTIKQWDIEKKKCVHTL 470 > Hs5453581 Length=252 Score = 32.7 bits (73), Expect = 0.15, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%) Query 5 RIITGSADGKIKLWDAKTQDCLSTFTPPVP 34 R+++G D ++K+WD T CL TF P Sbjct 7 RLVSGGRDCQVKVWDVDTGKCLKTFRHKDP 36 > Hs4557741 Length=410 Score = 32.7 bits (73), Expect = 0.16, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 P+ I++ S D IK+W+ +T C+ TFT Sbjct 202 PNGDHIVSASRDKTIKMWEVQTGYCVKTFT 231 Score = 28.5 bits (62), Expect = 3.2, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 0/24 (0%) Query 6 IITGSADGKIKLWDAKTQDCLSTF 29 +++GS D IK+WD T CL T Sbjct 311 LLSGSRDKTIKMWDVSTGMCLMTL 334 > 7301804 Length=326 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 0/24 (0%) Query 6 IITGSADGKIKLWDAKTQDCLSTF 29 I+TGS D +KLWD + + C+ TF Sbjct 110 ILTGSWDNTVKLWDMREKRCVGTF 133 > Hs4504053 Length=340 Score = 32.7 bits (73), Expect = 0.18, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 0/30 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFT 30 PD I+G+ D KLWD + C TFT Sbjct 194 PDFNLFISGACDASAKLWDVREGTCRQTFT 223 > CE26171 Length=1087 Score = 32.7 bits (73), Expect = 0.19, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLST 28 P NTR ++ SADG++ LW+ + C+ + Sbjct 83 PTNTRFVSASADGRVCLWEIQDGRCIDS 110 > Hs18544419 Length=446 Score = 32.3 bits (72), Expect = 0.20, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 2 DNTRIITGSADGKIKLWDAKTQDCLSTFT 30 D + I+TGS D KLWDA C++T T Sbjct 189 DCSLILTGSMDKTCKLWDATNGKCVATLT 217 Score = 32.0 bits (71), Expect = 0.31, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTF 29 P ++TGS+D ++WDA+T CL Sbjct 272 PQGNHLLTGSSDKTARIWDAQTGQCLQVL 300 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 0/29 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTF 29 P +I TGS D KLW +T C TF Sbjct 62 PYGDKIATGSFDKTCKLWSVETGKCYHTF 90 > At3g18140 Length=305 Score = 32.3 bits (72), Expect = 0.20, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPV 33 P+ T +I+G +G I++WD + C P V Sbjct 129 PNQTELISGDQNGNIRVWDLRANSCSCELVPEV 161 > Hs9506645 Length=330 Score = 32.3 bits (72), Expect = 0.21, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 1 PDNTRIITGSADGKIKLWDAKTQDCLSTFTPPVPP 35 P + II+GS D +K+W+ KT CL T + P Sbjct 135 PPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDP 169 Lambda K H 0.318 0.131 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1197406694 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40