bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_5089_orf2 Length=80 Score E Sequences producing significant alignments: (Bits) Value ECU11g1550i 68.9 2e-12 SPCC622.17 67.4 6e-12 CE28953 59.7 1e-09 YKL114c 57.4 6e-09 Hs22045837 31.2 0.51 CE23698_3 28.9 2.5 CE02574 27.7 5.1 > ECU11g1550i Length=275 Score = 68.9 bits (167), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Query 1 GYKFLRGMHLNDSKSELSSGLDRHELLGKGHLGLAPFKYIMQHQTRFKDMPLILETPDP 59 G +FL+ MH+NDSK L S DRHE +GKG +G F++IM + F ++PLILETPDP Sbjct 202 GLEFLKAMHINDSKEALGSKKDRHESIGKGMIGEKAFRFIMNSKV-FDNIPLILETPDP 259 > SPCC622.17 Length=366 Score = 67.4 bits (163), Expect = 6e-12, Method: Composition-based stats. Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Query 1 GYKFLRGMHLNDSKSELSSGLDRHELLGKGHLGLAPFKYIMQHQTRFKDMPLILETPDPT 60 G K++ G HLNDSK+ L S D HE +G G LGL PF+ IM + +R+ +PL+LETP + Sbjct 223 GAKYVSGWHLNDSKAPLGSNRDLHENIGLGFLGLEPFRLIM-NDSRWDGIPLVLETPAKS 281 Query 61 EGTIWKKEIK 70 WKKE++ Sbjct 282 PEQ-WKKEVE 290 > CE28953 Length=396 Score = 59.7 bits (143), Expect = 1e-09, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Query 1 GYKFLRGMHLNDSKSELSSGLDRHELLGKGHLGLAPFKYIMQHQTRFKDMPLILETPD 58 G+ +L+ +H+NDSK ++ S LDRHE +G+G +G A F+ +M + R +P+ILETP+ Sbjct 324 GWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAFELLM-NDNRLDGIPMILETPE 380 > YKL114c Length=367 Score = 57.4 bits (137), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 32/73 (43%), Positives = 47/73 (64%), Gaps = 4/73 (5%) Query 1 GYKFLRGMHLNDSKSELSSGLDRHELLGKGHLGLAPFKYIMQHQTRFKDMPLILETP-DP 59 G+K+L +HLNDSK+ L + D HE LG+G+LG+ F+ I H + +P++LETP + Sbjct 221 GFKYLSAVHLNDSKAPLGANRDLHERLGQGYLGIDVFRMIA-HSEYLQGIPIVLETPYEN 279 Query 60 TEGTIWKKEIKQM 72 EG + EIK M Sbjct 280 DEG--YGNEIKLM 290 > Hs22045837 Length=252 Score = 31.2 bits (69), Expect = 0.51, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query 5 LRGMHLNDSKSELSSGLDRHELLGK----GHLGLAPFKYIMQHQTRFKDMPLILETPDPT 60 +RG H +DS+ L S D ++ G++ P+ M+ QTR + P + T DP+ Sbjct 42 IRGHHYSDSRRSLESFRDHAAIIYPQHHCGNISTGPYTVRMEPQTRQQQQPGGVGTSDPS 101 > CE23698_3 Length=454 Score = 28.9 bits (63), Expect = 2.5, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query 10 LNDSKSELSSGLDRHELLGK--GHLGLAPFKYIM 41 L D SE S LD HE+LG GH+G F I+ Sbjct 342 LADVISETRSDLDEHEILGTVVGHVGDGNFHVIL 375 > CE02574 Length=320 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 0/63 (0%) Query 15 SELSSGLDRHELLGKGHLGLAPFKYIMQHQTRFKDMPLILETPDPTEGTIWKKEIKQMYL 74 S LS L+R + L H+ L P + + +F+ + DP++ + IK+M+ Sbjct 13 SALSIPLNRSDFLENDHVELMPLEKDGELNDKFRQEMIFSHNLDPSDSKQLSESIKEMFK 72 Query 75 GRD 77 D Sbjct 73 KTD 75 Lambda K H 0.319 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1165602088 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40