bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4672_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value Hs4503143 65.9 2e-11 CE19495 65.5 2e-11 At1g62290 58.2 3e-09 At1g11910 56.6 1e-08 CE03567 56.2 1e-08 7304149 56.2 1e-08 At4g04460 55.5 2e-08 Hs4503145 54.7 4e-08 Hs4506475 54.7 4e-08 Hs4758754 53.9 7e-08 7303185 53.1 1e-07 YPL154c 51.6 4e-07 Hs22063872 50.4 7e-07 Hs22063875 50.4 7e-07 Hs22063919 48.1 4e-06 CE21681 39.3 0.002 CE20430 38.1 0.004 Hs4505757 37.7 0.005 CE11478 36.6 0.011 CE21685 36.6 0.012 Hs18549644 36.6 0.013 YDR144c 35.4 0.028 7300254 35.0 0.032 CE09541 34.3 0.053 7300255 33.5 0.11 CE04971 33.1 0.12 7297766 33.1 0.13 7296075 32.7 0.17 CE09540 32.0 0.31 CE11480 31.6 0.39 CE09542 31.2 0.43 7297765 30.8 0.66 CE17748 30.4 0.91 Hs5031985 29.3 1.8 CE09539 29.3 1.8 At3g51330 29.3 1.8 7297427 28.5 3.4 7296076 28.5 3.5 CE09738 28.1 3.6 CE24236 28.1 4.5 YLR121c 27.7 5.1 At1g70060 27.7 5.1 CE16843 27.7 5.2 YLR120c 27.3 6.9 YIL015w 27.3 7.1 > Hs4503143 Length=412 Score = 65.9 bits (159), Expect = 2e-11, Method: Composition-based stats. Identities = 25/44 (56%), Positives = 34/44 (77%), Gaps = 0/44 (0%) Query 39 CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 C +GFM MD+P P GPL++LG+ FI +YY++FDRD+ VGF A Sbjct 366 CLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEA 409 > CE19495 Length=398 Score = 65.5 bits (158), Expect = 2e-11, Method: Composition-based stats. Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 12/85 (14%) Query 6 ERERERELVPLVPN----------SARG-DYVVEELDARGNANNCAAGFMAMDVPAPRGP 54 E E E +P +PN +G DY+++ + G + C +GFM MD+PAP GP Sbjct 308 EYEVECSKIPSLPNITFNLGGQNFDLQGKDYILQMSNGNG-GSTCLSGFMGMDIPAPAGP 366 Query 55 LFVLGNSFIRKYYSIFDRDHMMVGF 79 L++LG+ FI ++YS+FD + VGF Sbjct 367 LWILGDVFIGRFYSVFDHGNKRVGF 391 > At1g62290 Length=526 Score = 58.2 bits (139), Expect = 3e-09, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 0/51 (0%) Query 32 ARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 G C +GF A+D+P PRGPL++LG+ F+ KY+++FD + VGF A Sbjct 475 GEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA 525 > At1g11910 Length=506 Score = 56.6 bits (135), Expect = 1e-08, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 0/51 (0%) Query 32 ARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 G C +GF+A+DV PRGPL++LG+ F+ KY+++FD + VGF A Sbjct 455 GEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA 505 > CE03567 Length=444 Score = 56.2 bits (134), Expect = 1e-08, Method: Composition-based stats. Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Query 24 DYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRAN 83 DYV++ ++G C +GFM +D+P G L++LG+ FI +YYS+FD D VGF +A Sbjct 356 DYVLKV--SQGGKTICLSGFMGIDLPERVGELWILGDVFIGRYYSVFDFDQNRVGFAQAK 413 Query 84 HEGSGPL 90 P+ Sbjct 414 TADGRPV 420 > 7304149 Length=392 Score = 56.2 bits (134), Expect = 1e-08, Method: Composition-based stats. Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%) Query 39 CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 C +GFM +D+P P GPL++LG+ FI KYY+ FD + VGF A Sbjct 348 CLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADA 391 > At4g04460 Length=508 Score = 55.5 bits (132), Expect = 2e-08, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 0/51 (0%) Query 32 ARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 G + C +GF AMD+ PRGPL++LG+ F+ Y+++FD VGF +A Sbjct 457 GEGVESQCTSGFTAMDIAPPRGPLWILGDIFMGPYHTVFDYGKGRVGFAKA 507 > Hs4503145 Length=396 Score = 54.7 bits (130), Expect = 4e-08, Method: Composition-based stats. Identities = 21/44 (47%), Positives = 32/44 (72%), Gaps = 0/44 (0%) Query 39 CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 C++GF +D+ P GPL++LG+ FIR++YS+FDR + VG A Sbjct 351 CSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPA 394 > Hs4506475 Length=406 Score = 54.7 bits (130), Expect = 4e-08, Method: Composition-based stats. Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Query 23 GDYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 DYV +E + + C AMD+P P GP + LG +FIRK+Y+ FDR + +GF A Sbjct 348 ADYVFQE--SYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA 405 > Hs4758754 Length=420 Score = 53.9 bits (128), Expect = 7e-08, Method: Composition-based stats. Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 6/68 (8%) Query 24 DYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMM----VGF 79 DYV++ R C +GF A+DVP P GP ++LG+ F+ Y ++FDR M VG Sbjct 341 DYVIQT--TRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGL 398 Query 80 MRANHEGS 87 RA G+ Sbjct 399 ARARTRGA 406 > 7303185 Length=404 Score = 53.1 bits (126), Expect = 1e-07, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 33/44 (75%), Gaps = 0/44 (0%) Query 39 CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 C++ F+A+D+P+P GPL++LG+ F+ KYY+ FD + +GF A Sbjct 359 CSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFADA 402 > YPL154c Length=405 Score = 51.6 bits (122), Expect = 4e-07, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 36 ANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 + +C + MD P P GPL ++G++F+RKYYSI+D + VG +A Sbjct 358 SGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKA 404 > Hs22063872 Length=325 Score = 50.4 bits (119), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 0/42 (0%) Query 38 NCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGF 79 +C +GF M++P G L++LG+ FIR+Y+++FDR + VG Sbjct 280 SCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGL 321 > Hs22063875 Length=325 Score = 50.4 bits (119), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 0/42 (0%) Query 38 NCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGF 79 +C +GF M++P G L++LG+ FIR+Y+++FDR + VG Sbjct 280 SCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGL 321 > Hs22063919 Length=267 Score = 48.1 bits (113), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 38 NCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDR 72 +C +GF M++P G L++LG+ FIR+Y+++FDR Sbjct 224 SCISGFQGMNLPTESGELWILGDVFIRQYFTVFDR 258 > CE21681 Length=396 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query 30 LDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRANHEG 86 LD + CA +M GP ++LG++FIR+Y +++D + +GF A H+G Sbjct 340 LDLQLGGGKCALAVFSMG-SGGFGPSWILGDTFIRQYCNVYDIGNGQIGFATAVHKG 395 > CE20430 Length=638 Score = 38.1 bits (87), Expect = 0.004, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query 39 CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRANH 84 CA +D GP LGN FIR+Y S+FD + +GF A H Sbjct 343 CALAMYGIDASG-FGPSVTLGNIFIRRYCSVFDVGNARIGFADAIH 387 > Hs4505757 Length=388 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 11/69 (15%) Query 15 PLVPNSARGDYVVEELDARGNANNCAAGFMAMDVPAPRG-PLFVLGNSFIRKYYSIFDRD 73 PL P+S Y++ N C G + + G PL++LG+ F+R YYS++D Sbjct 329 PLPPSS----YILS------NNGYCTVGVEPTYLSSQNGQPLWILGDVFLRSYYSVYDLG 378 Query 74 HMMVGFMRA 82 + VGF A Sbjct 379 NNRVGFATA 387 > CE11478 Length=383 Score = 36.6 bits (83), Expect = 0.011, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 50 APRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 +P GPL+V G++F+R Y IFD + +G +A Sbjct 347 SPSGPLWVFGDNFLRSYCHIFDFGNSRIGLAKA 379 > CE21685 Length=829 Score = 36.6 bits (83), Expect = 0.012, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGFMRANH 84 GP ++LG+ FIR+Y +I+D + +GF A+H Sbjct 796 GPSWILGDVFIRQYCNIYDIGNARIGFANAHH 827 > Hs18549644 Length=110 Score = 36.6 bits (83), Expect = 0.013, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Query 39 CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 C +GF D + + ++LGN FI +YYS+FDR + VG +A Sbjct 70 CTSGFQG-DYSSQQ---WILGNVFIWEYYSVFDRTNNRVGLAKA 109 > YDR144c Length=596 Score = 35.4 bits (80), Expect = 0.028, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 9/72 (12%) Query 31 DARGNANNCAAGFMAMDVPAPRG-PLFVLGNSFIRKYYSIFDRDHMMVGFMRANHEGSGP 89 D+R N C G AP+ P +LG++F+ Y ++D D+M + +AN G Sbjct 426 DSRSNI--CILGI------APQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGE 477 Query 90 LIKGFPSSASSA 101 I+ S+ SA Sbjct 478 YIEIIESAVPSA 489 > 7300254 Length=309 Score = 35.0 bits (79), Expect = 0.032, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 7/59 (11%) Query 24 DYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 DY++E L R A C P RG +VLG+ F+R+YY++FD +G +A Sbjct 257 DYIMEVLLDRKPA--CVLAI----APINRG-FWVLGDIFLRRYYTVFDATEKRIGLAKA 308 > CE09541 Length=350 Score = 34.3 bits (77), Expect = 0.053, Method: Compositional matrix adjust. Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query 15 PLVPNSARGDYVVEELDARGNANN--CAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDR 72 PL DY +E + + + C MD GP ++LG+ FIR+Y +I+D Sbjct 276 PLEVTIGGHDYQIEHYNYIADVGDGTCVMALFPMDFGG-FGPSWILGDPFIRQYCNIYDI 334 Query 73 DHMMVGF 79 + +GF Sbjct 335 GNFRMGF 341 > 7300255 Length=395 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 6/59 (10%) Query 24 DYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 DYV+ + G++ C + F MD ++LG+ FI +YY+ FD +GF A Sbjct 342 DYVMSATNDDGSSI-CLSAFTLMD-----AEFWILGDVFIGRYYTAFDAGQRRIGFAPA 394 > CE04971 Length=709 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query 36 ANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 +NNC GP ++LG+ FIR+Y +I+D VGF ++ Sbjct 660 SNNCIYAIFPFS-SGGFGPSWILGDPFIRQYCNIYDVGTQRVGFAKS 705 > 7297766 Length=391 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 6/58 (10%) Query 24 DYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMR 81 DY+V+ + C + F M+ + ++LG+ FI K+Y++FD+ + +GF R Sbjct 336 DYIVKV--TQNGQTYCMSAFTYMEGLS----FWILGDVFIGKFYTVFDKGNERIGFAR 387 > 7296075 Length=410 Score = 32.7 bits (73), Expect = 0.17, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Query 36 ANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRANH 84 N C +GF +M+ L +LG F+ YY+ +D + ++G A H Sbjct 366 GNTCVSGFTSMN----GNSLLILGEIFLGAYYTTYDIVYKLIGLAPAIH 410 > CE09540 Length=395 Score = 32.0 bits (71), Expect = 0.31, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 GP ++ G+ FIR+Y +I+D +GF ++ Sbjct 360 GPSWIFGDPFIRQYCNIYDIGQQRIGFAKS 389 > CE11480 Length=474 Score = 31.6 bits (70), Expect = 0.39, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGFMRA 82 GP ++LG++F+R Y +FD + +G +A Sbjct 441 GPAWILGDNFLRSYCHVFDFGNSRIGLAKA 470 > CE09542 Length=389 Score = 31.2 bits (69), Expect = 0.43, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGF 79 GP ++LG+ FIR+Y +I+D + +GF Sbjct 357 GPSWILGDPFIRQYCNIYDIGNKRMGF 383 > 7297765 Length=423 Score = 30.8 bits (68), Expect = 0.66, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 5/64 (7%) Query 24 DYVVEELDARGNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRAN 83 DY+ + + A N C +GF + L++LG+ F+ K Y++FD +GF + Sbjct 334 DYIYK-VQADNNQTLCLSGFTYLQ----GNLLWILGDIFLGKVYTVFDVGKERIGFAKLK 388 Query 84 HEGS 87 S Sbjct 389 KHSS 392 > CE17748 Length=836 Score = 30.4 bits (67), Expect = 0.91, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 78 GFMRANHEGSGPLIKGFPSSASSASASCLVAASAAAIALAF 118 GF + + S P K FP++A+S S VA S + A +F Sbjct 167 GFEKNSFSRSSPYFKAFPTAATSQFVSSHVATSQNSFATSF 207 > Hs5031985 Length=127 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 58 LGNSFIRKYYSIFDRDHMMVG 78 +G+SFI+ YY +FD D +G Sbjct 10 IGSSFIQHYYQLFDNDRTQLG 30 > CE09539 Length=393 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGF 79 GP ++LG+ FIR++ +I+D +GF Sbjct 360 GPAWILGDPFIRQFCNIYDIGGQRMGF 386 > At3g51330 Length=519 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 20/27 (74%), Gaps = 0/27 (0%) Query 57 VLGNSFIRKYYSIFDRDHMMVGFMRAN 83 ++G +F+ Y +FDR+ M++G+ R++ Sbjct 416 IIGQNFMSGYRIVFDRERMILGWKRSD 442 > 7297427 Length=372 Score = 28.5 bits (62), Expect = 3.4, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Query 38 NCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGF 79 NC + F M ++LG+ FI +YY+ FD + +GF Sbjct 332 NCMSAFEYMGTD-----FWILGDVFIGQYYTEFDLGNNRIGF 368 > 7296076 Length=405 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Query 34 GNANNCAAGFMAMDVPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGF 79 GN C + F + ++LG+ F+ +YYS FD VGF Sbjct 361 GNYTTCMSTFTDIGTG-----FWILGDVFLGQYYSEFDFGQNRVGF 401 > CE09738 Length=389 Score = 28.1 bits (61), Expect = 3.6, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGF 79 GP ++LG F+R+Y ++ D VGF Sbjct 358 GPSWILGGPFMRQYCNVHDIGQKRVGF 384 > CE24236 Length=365 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 0/38 (0%) Query 17 VPNSARGDYVVEELDARGNANNCAAGFMAMDVPAPRGP 54 +P SA+ DY E+ D GN C + ++V P Sbjct 3 IPKSAKSDYTKEQKDLVGNICQCKDFYKILNVDKKASP 40 > YLR121c Length=508 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 48 VPAPRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRANHEGSG 88 +P +LG+SF+R Y ++D D+ + +A + G+G Sbjct 362 IPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKY-GTG 401 > At1g70060 Length=1386 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query 2 ERERERERERELVPLVPNSARGDYVVEELDARGNANNCAAGF 43 ER RER+RE+E + V S + + ELD N C + Sbjct 432 ERYRERDREKERLEKVAASQKWAKPISELDL-SNCEQCTPSY 472 > CE16843 Length=394 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 53 GPLFVLGNSFIRKYYSIFDRDHMMVGFMRANHE 85 GP ++LG+ FIR++ +I D + +G + + Sbjct 362 GPSWILGDPFIRQFCNIHDIKNKRIGLAHSKQQ 394 > YLR120c Length=569 Score = 27.3 bits (59), Expect = 6.9, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 0/45 (0%) Query 57 VLGNSFIRKYYSIFDRDHMMVGFMRANHEGSGPLIKGFPSSASSA 101 +LG+SF+ Y ++D +++ + +A + + I+ SS SA Sbjct 452 ILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSA 496 > YIL015w Length=587 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 0/37 (0%) Query 51 PRGPLFVLGNSFIRKYYSIFDRDHMMVGFMRANHEGS 87 P VLG+ F+ Y +FD D+ + +AN S Sbjct 364 PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNAS 400 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164469306 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40