bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4515_orf1 Length=50 Score E Sequences producing significant alignments: (Bits) Value Hs14150013 90.9 5e-19 Hs22040945 70.1 1e-12 CE19378 33.5 0.088 At5g13240 33.1 0.11 SPAC31G5.12c 31.6 0.33 YDR005c 28.5 2.8 ECU11g2080i 27.3 6.1 ECU10g0060 27.3 6.1 > Hs14150013 Length=256 Score = 90.9 bits (224), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%) Query 3 GSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDM 44 GSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDM Sbjct 181 GSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDM 222 > Hs22040945 Length=149 Score = 70.1 bits (170), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 0/40 (0%) Query 4 SLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELD 43 +LWSFNYFFYNK LK+IVFFS RSIS ST TPSEAGNE+D Sbjct 85 TLWSFNYFFYNKGLKQIVFFSHRSISSSTCTPSEAGNEMD 124 > CE19378 Length=245 Score = 33.5 bits (75), Expect = 0.088, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 3 GSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSE 37 G +W+ + FYNK LKR V + R +S T E Sbjct 196 GCIWALAFIFYNKGLKRFVLLTIRCLSKQADTSIE 230 > At5g13240 Length=283 Score = 33.1 bits (74), Expect = 0.11, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Query 3 GSLWSFNYFFYNKRLKRIV--FFSCRS 27 G++WSF + FYN++LKR+ FSC S Sbjct 231 GAIWSFCFLFYNRKLKRVAGFRFSCTS 257 > SPAC31G5.12c Length=215 Score = 31.6 bits (70), Expect = 0.33, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 5 LWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELD 43 +W +YFF+NK +KR+++ S + + GN+ D Sbjct 152 IWGMSYFFFNKNMKRMLYLSLHGLGKEVSGRNRYGNDDD 190 > YDR005c Length=395 Score = 28.5 bits (62), Expect = 2.8, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Query 2 PGSLWSFNYFFYNKRLKRI--VFFSCRSISGST 32 PG LW+ F YN++ KR+ ++ C ++ ST Sbjct 315 PGYLWNLIGFLYNRKRKRVAYLYLICSRLNSST 347 > ECU11g2080i Length=283 Score = 27.3 bits (59), Expect = 6.1, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 5 LWSFNYFFYNKRLKRIVFFS 24 LW F++ F+NK+ +R+V + Sbjct 258 LWYFSFLFFNKKQRRVVMLN 277 > ECU10g0060 Length=283 Score = 27.3 bits (59), Expect = 6.1, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 15/20 (75%), Gaps = 0/20 (0%) Query 5 LWSFNYFFYNKRLKRIVFFS 24 LW F++ F+NK+ +R+V + Sbjct 258 LWYFSFLFFNKKQRRVVMLN 277 Lambda K H 0.319 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1164550556 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40