bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_4467_orf1 Length=56 Score E Sequences producing significant alignments: (Bits) Value Hs7706706 98.6 3e-21 CE19073 61.6 4e-10 Hs22056379 58.5 3e-09 7294889 57.4 7e-09 Hs16418371 56.6 1e-08 Hs22045770_2 35.8 0.018 Hs20548274 34.7 0.045 Hs22043051 29.3 1.7 CE24576 28.5 2.8 Hs22041951 28.1 3.8 SPBC14F5.11c 27.3 6.2 > Hs7706706 Length=595 Score = 98.6 bits (244), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 44/47 (93%), Positives = 46/47 (97%), Gaps = 0/47 (0%) Query 9 EAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAEKDELGGVM 55 +AWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAE+DEL GVM Sbjct 332 QAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVM 378 > CE19073 Length=361 Score = 61.6 bits (148), Expect = 4e-10, Method: Composition-based stats. Identities = 27/51 (52%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Query 4 RNSAPEAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAEKDE-LGG 53 R + W+ ++CRHPV+S+SEV+ F++ DEK+WK GKR+AEKDE +GG Sbjct 93 RKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGG 143 > Hs22056379 Length=574 Score = 58.5 bits (140), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 0/44 (0%) Query 11 WMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAEKDELGGV 54 WM M HPV+S+ E FQ FL+ D+K+WK GKR+AEKDE+ G Sbjct 313 WMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGA 356 > 7294889 Length=531 Score = 57.4 bits (137), Expect = 7e-09, Method: Composition-based stats. Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 0/40 (0%) Query 15 MCRHPVISESEVFQQFLNFRDEKEWKTGKRKAEKDELGGV 54 +CRHPVIS+ EV+ FL RDEK WK+GKRKAE+D GV Sbjct 272 VCRHPVISKCEVWYHFLTCRDEKIWKSGKRKAERDPYMGV 311 > Hs16418371 Length=628 Score = 56.6 bits (135), Expect = 1e-08, Method: Composition-based stats. Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 3/46 (6%) Query 11 WMTRMCRHPVISESEVFQQFL---NFRDEKEWKTGKRKAEKDELGG 53 WM M HPV+++ +VFQ FL + DEK WK GKRKAEKDE+ G Sbjct 359 WMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVG 404 > Hs22045770_2 Length=150 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Query 3 CRNSAPEAWMTRMCRHPVISESEVFQQFL---NFRDEKEWKTGKRKAEKDEL 51 CR P +WM M V ++ VF F+ +E W+ GKRKA KDE+ Sbjct 5 CRK-GPISWMNHMASFWVQAQCHVFHHFVMCHTSTEETAWRQGKRKAAKDEV 55 > Hs20548274 Length=489 Score = 34.7 bits (78), Expect = 0.045, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Query 3 CRNSAPEAWMTRMCRHPVISESEVFQQFL---NFRDEKEWKTGKRKAEKDELG 52 CR P WM + ++ +F FL E W+ GKRKAEKDELG Sbjct 323 CRK-GPIWWMNHTASFWMQAQCHIFCHFLMRPTSTKETAWRQGKRKAEKDELG 374 > Hs22043051 Length=226 Score = 29.3 bits (64), Expect = 1.7, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Query 20 VISESEVFQQFL---NFRDEKEWKTGKRKAEKDEL 51 V ++ +F FL +E W+ GKRKAEKDE+ Sbjct 95 VQAQCHIFCHFLMCPTSTEETAWRQGKRKAEKDEM 129 > CE24576 Length=1628 Score = 28.5 bits (62), Expect = 2.8, Method: Compositional matrix adjust. Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 0/20 (0%) Query 11 WMTRMCRHPVISESEVFQQF 30 WM+ C H ++S EVF QF Sbjct 1290 WMSTTCNHAMLSVVEVFTQF 1309 > Hs22041951 Length=231 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query 25 EVFQQFL---NFRDEKEWKTGKRKAEKDE 50 +F FL +E W+ GKRKAEKDE Sbjct 93 HIFCHFLMCPTSTEETAWRQGKRKAEKDE 121 > SPBC14F5.11c Length=586 Score = 27.3 bits (59), Expect = 6.2, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 4 RNSAPEAWMTRMCRHPVISESEVFQQFLN 32 R + ++ R+ +HP++ SEVF++FL+ Sbjct 152 RKRLLQLFLRRVAQHPILGLSEVFRKFLS 180 Lambda K H 0.317 0.133 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40