bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3954_orf3 Length=144 Score E Sequences producing significant alignments: (Bits) Value Hs15529982 45.1 5e-05 YNL075w 45.1 5e-05 7301265 44.7 5e-05 SPAC19A8.07c 42.7 2e-04 CE18464 41.6 5e-04 At1g63780 40.0 0.002 Hs13376605 39.7 0.002 7297917 39.7 0.002 At4g01560 37.4 0.009 CE28332 32.0 0.44 CE08553 28.9 3.5 CE27963 27.7 7.0 > Hs15529982 Length=291 Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 20/32 (62%), Positives = 24/32 (75%), Gaps = 0/32 (0%) Query 1 GQPPRLIVFHLPHGPTAHFTLSGVCLRHDLPE 32 G P LIV HLP GPTA+FTL V +RHD+P+ Sbjct 144 GTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPD 175 > YNL075w Length=290 Score = 45.1 bits (105), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 20/40 (50%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query 1 GQPPRLIVFHLPHGPTAHFTLSGVCLRHDLPERAPNMSQV 40 G P L + H PHGPTA F+L V +RHD+ A N S+V Sbjct 147 GVPTSLTISHFPHGPTAQFSLHNVVMRHDIIN-AGNQSEV 185 > 7301265 Length=298 Score = 44.7 bits (104), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%) Query 1 GQPPRLIVFHLPHGPTAHFTLSGVCLRHDLPE 32 G P L+V HLP+GPTA F +S V +RHD+P+ Sbjct 142 GIPDSLVVCHLPYGPTAFFNISDVVMRHDIPD 173 > SPAC19A8.07c Length=289 Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 1 GQPPRLIVFHLPHGPTAHFTLSGVCLRHDLP 31 G P L++ HLP+GPT F+L V LRHD+P Sbjct 145 GIPDGLVISHLPYGPTLSFSLHNVVLRHDIP 175 > CE18464 Length=292 Score = 41.6 bits (96), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 23/31 (74%), Gaps = 0/31 (0%) Query 1 GQPPRLIVFHLPHGPTAHFTLSGVCLRHDLP 31 G P ++V HLP GPTA F+++ V +RHD+P Sbjct 139 GNPDGMLVCHLPFGPTAFFSMANVVMRHDIP 169 > At1g63780 Length=294 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 12/66 (18%) Query 1 GQPPRLIVFHLPHGPTAHFTLSGVCLRHD---------LPERAPNMSQVLFCCCCSAAAA 51 G P LI+ HLP GPTA+F L V RHD +PE+ P++ +F + Sbjct 144 GVPDGLIISHLPFGPTAYFGLLNVVTRHDISDKKSIGKMPEQYPHL---IFNNFTTQMGQ 200 Query 52 AAAALL 57 +L Sbjct 201 RVGNIL 206 > Hs13376605 Length=349 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 0/34 (0%) Query 3 PPRLIVFHLPHGPTAHFTLSGVCLRHDLPERAPN 36 P LI+ HLP+GPTAHF +S V LR ++ R + Sbjct 205 PNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKD 238 > 7297917 Length=394 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 2 QPPRLIVFHLPHGPTAHFTLSGVCLRHDL 30 +P L+V HLP+GPTAHF LS V L D+ Sbjct 247 KPNGLLVIHLPNGPTAHFKLSNVKLTSDI 275 > At4g01560 Length=343 Score = 37.4 bits (85), Expect = 0.009, Method: Compositional matrix adjust. Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 2 QPPRLIVFHLPHGPTAHFTLSGVCLRHDL 30 +P L++ LP+GPTAHF LS + LR D+ Sbjct 189 EPDALLIIGLPNGPTAHFKLSNLVLRKDI 217 > CE28332 Length=384 Score = 32.0 bits (71), Expect = 0.44, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query 2 QPPRLIVF-HLPHGPTAHFTLSGVCLRHDL 30 + P I+F HLP GPTA+F ++ + DL Sbjct 238 KKPNGIIFCHLPEGPTAYFKINSLTFTQDL 267 > CE08553 Length=461 Score = 28.9 bits (63), Expect = 3.5, Method: Composition-based stats. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query 3 PPRLIVFHLPHGPTAHFTLSGVCLRHDLPERAPNMSQVLF 42 P L +F LP P+AH L+G + H P +PNM V F Sbjct 115 PLCLKLFSLPFAPSAH--LTGPFISH-YPHYSPNMDAVSF 151 > CE27963 Length=652 Score = 27.7 bits (60), Expect = 7.0, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 0/48 (0%) Query 50 AAAAAALLLLPFWRLLRAAPVCLFAAAAAVLLLLECRCCRELPPLLRC 97 +A AL++ L + P C+ +A V+L R C LP L RC Sbjct 393 SACFMALVITTIGPYLASLPSCILSAIVIVVLESMLRKCTVLPGLWRC 440 Lambda K H 0.330 0.141 0.483 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1675978996 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40