bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3584_orf1 Length=175 Score E Sequences producing significant alignments: (Bits) Value 7299738 36.2 0.035 YKR054c 32.7 0.40 7292723 32.3 0.45 Hs13430872 32.0 0.61 CE11866 31.6 0.84 At4g13730 31.2 1.2 7300962 30.4 2.1 At4g36980 30.0 2.4 CE00855 30.0 2.8 At3g06160 29.6 3.2 Hs7661998 29.3 4.3 7292091 29.3 4.7 Hs22049723 28.1 9.8 > 7299738 Length=654 Score = 36.2 bits (82), Expect = 0.035, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 13/104 (12%) Query 72 EAAVAGDSSGTPAQGERLVVPFLRRLHWARLLGLLSGDTLEEWAEQVKEQRQQYESLRRQ 131 ++A AGD L + R +HWA LL +L+ + W Q +QR +Y+ R Sbjct 64 QSAFAGD----------LKMSKFRSVHWALLLRVLTSEH-RSWTSQRLQQRVRYDKFRAD 112 Query 132 QQLSASQLAALDPQRFHPLAATAGNPWSQKQADEELQEEIWRDI 175 + QL A+D PL+ + + W+Q +D++L I +D+ Sbjct 113 YVRNPHQL-AVDCND-DPLSQSTQSVWNQYFSDQDLFAVIRQDV 154 > YKR054c Length=4092 Score = 32.7 bits (73), Expect = 0.40, Method: Composition-based stats. Identities = 27/113 (23%), Positives = 52/113 (46%), Gaps = 12/113 (10%) Query 37 HSTANFPLKTLAEHV---LYGDAVDRQQLDIVRLQRQLEAAVAGDSSGTPAQGERLVVPF 93 +ST N P + +H+ +YG +D ++ D+ + + G + G R+ P Sbjct 3975 NSTNNIPWAQVRDHIATIVYGGKIDEEK-DLEVVAKLCAHVFCGSDNLQIVPGVRIPQPL 4033 Query 94 LRRLH---WARLLGLLS-----GDTLEEWAEQVKEQRQQYESLRRQQQLSASQ 138 L++ ARL +LS D+L W + +E YE L+ ++ S+++ Sbjct 4034 LQQSEEEERARLTAILSNTIEPADSLSSWLQLPRESILNYERLQAKEVASSTE 4086 > 7292723 Length=1848 Score = 32.3 bits (72), Expect = 0.45, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Query 102 LLGLLSGDTLEEWAEQVKEQRQQYESLRRQQQL 134 +LG+LSG+ +E E+V E RQ++ LRRQQQL Sbjct 308 VLGVLSGEFAKE-REKV-ENRQEFLKLRRQQQL 338 > Hs13430872 Length=638 Score = 32.0 bits (71), Expect = 0.61, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query 114 WAEQVKEQR---QQYESLRRQQQLSASQLAALDPQRFHPLAATAGNPWSQKQADEELQEE 170 W E+V++QR Q+ E ++RQ++L Q L PQ + A + ++L + Sbjct 507 WVEEVRKQRRLLQREEKVKRQERLKEDQQTVLKPQFYEIKAGEEFRSFKDSATKQKLMNK 566 Query 171 IWRD 174 D Sbjct 567 TLED 570 > CE11866 Length=961 Score = 31.6 bits (70), Expect = 0.84, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 5/71 (7%) Query 46 TLAEHVLYGD---AVDRQQLDIVRLQ--RQLEAAVAGDSSGTPAQGERLVVPFLRRLHWA 100 T+ ++VL G +D+ LD + Q ++ A A + +G P +G+ V+P L +L Sbjct 630 TMIQYVLNGGQIPGIDKATLDKIVKQTMNKMHTAAAANLAGNPVEGQEKVLPPLDKLPSG 689 Query 101 RLLGLLSGDTL 111 + ++SG+ L Sbjct 690 LVTQVMSGEPL 700 > At4g13730 Length=449 Score = 31.2 bits (69), Expect = 1.2, Method: Compositional matrix adjust. Identities = 24/106 (22%), Positives = 46/106 (43%), Gaps = 25/106 (23%) Query 94 LRRLHWARLLGLLSGDTLEEWAEQVKEQRQQYESLRRQQQLSASQLA----------ALD 143 +R + W LL LS D W+ ++ ++R QY+ + + ++ S++ + D Sbjct 131 IRSIVWKLLLDYLSPDR-SLWSSELAKKRSQYKQFKEELLMNPSEVTRKMDKSKGGDSND 189 Query 144 PQ--------------RFHPLAATAGNPWSQKQADEELQEEIWRDI 175 P+ HPL+ + W+ D E+ E+I RD+ Sbjct 190 PKIESPGALSRSEITHEDHPLSLGTTSLWNNFFKDTEVLEQIERDV 235 > 7300962 Length=828 Score = 30.4 bits (67), Expect = 2.1, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Query 50 HVLYGDAVDRQQLDIVRLQRQLEAAVAGDSS------GTPAQGERLVVPFLRRLHWARLL 103 H+L D+ D L I LQ + AA+ DS+ T A L P RR+HW L Sbjct 331 HILQADSADMLSLWISALQHSIGAAIQHDSTHHSRPQSTNAPNNSL--PAKRRIHWEEFL 388 > At4g36980 Length=550 Score = 30.0 bits (66), Expect = 2.4, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 2/68 (2%) Query 73 AAVAGDSSGTPAQGERLVVP--FLRRLHWARLLGLLSGDTLEEWAEQVKEQRQQYESLRR 130 + VAG SS +Q E+ P L+R+ +L + D+ E A++ +++RQ+ E L Sbjct 361 SKVAGTSSSKQSQAEKKETPQERLKRIMNKQLTKQIKKDSATETAKKREQERQRLEKLAE 420 Query 131 QQQLSASQ 138 +LS ++ Sbjct 421 TSRLSRNR 428 > CE00855 Length=585 Score = 30.0 bits (66), Expect = 2.8, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 2/82 (2%) Query 95 RRLHWARLLGLLSGDTLEEWAEQVKEQRQQYESLRRQQQLSASQLA-ALDPQRFHPLAAT 153 R W +L L +T +W + R Y + + + + DP+ +PLA+ Sbjct 46 RSAVWRLVLRCLPYET-SDWEISLSRSRNLYRAHKENHLIDPHDTKFSQDPEFNNPLASI 104 Query 154 AGNPWSQKQADEELQEEIWRDI 175 NPW+ D +L++ I +D+ Sbjct 105 EQNPWNTFFEDNDLRDIIGKDV 126 > At3g06160 Length=330 Score = 29.6 bits (65), Expect = 3.2, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 0/48 (0%) Query 9 MDDTAPEGEVGLLQLTPDVLPALSRAVEHSTANFPLKTLAEHVLYGDA 56 + D + V L + L +LS HST+N L++L+ L+GDA Sbjct 130 ISDDTEDDNVSLHSPSNVSLDSLSNDSHHSTSNVSLRSLSNDSLHGDA 177 > Hs7661998 Length=795 Score = 29.3 bits (64), Expect = 4.3, Method: Compositional matrix adjust. Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Query 94 LRRLHWARLLGLLSGDTLEEWAEQVKEQRQQYESLRRQQQLSASQLAAL-DPQRFHPLAA 152 R + W L +L D +W +++E R Y +++ + ++ D +PL+ Sbjct 86 FRSICWKLFLCVLPQDK-SQWISRIEELRAWYSNIKEIHITNPRKVVGQQDLMINNPLSQ 144 Query 153 TAGNPWSQKQADEELQEEIWRDI 175 G+ W++ D+EL+ I +D+ Sbjct 145 DEGSLWNKFFQDKELRSMIEQDV 167 > 7292091 Length=866 Score = 29.3 bits (64), Expect = 4.7, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 0/51 (0%) Query 63 DIVRLQRQLEAAVAGDSSGTPAQGERLVVPFLRRLHWARLLGLLSGDTLEE 113 D R R L VA P GE + LR L RL+ S DT+EE Sbjct 628 DFHRFGRNLYEPVAYRLGWEPRDGENHLDTLLRSLVLTRLVSFRSSDTIEE 678 > Hs22049723 Length=280 Score = 28.1 bits (61), Expect = 9.8, Method: Compositional matrix adjust. Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 0/50 (0%) Query 119 KEQRQQYESLRRQQQLSASQLAALDPQRFHPLAATAGNPWSQKQADEELQ 168 K + Q Y S+ + + + SQ+ +RFH + + W + EE+Q Sbjct 214 KRRFQLYRSMNSRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQ 263 Lambda K H 0.315 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2671071884 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40