bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_3156_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value Hs11225260 52.0 2e-07 Hs16418461 50.4 8e-07 At5g55300 49.3 2e-06 7293054 47.0 9e-06 At5g55310 46.2 1e-05 SPBC1703.14c 44.7 4e-05 CE12282 44.3 5e-05 CE12284 44.3 6e-05 YOL006c 43.1 1e-04 At5g52550 28.9 2.5 > Hs11225260 Length=765 Score = 52.0 bits (123), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 22/30 (73%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL+ LM GL+AK+FRTYNASITLQQ+L++L Sbjct 576 HLQDLMEGLTAKVFRTYNASITLQQQLKEL 605 > Hs16418461 Length=601 Score = 50.4 bits (119), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 21/30 (70%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HL++LM GL+AK+FRTYNASITLQ++L+ L Sbjct 412 HLQELMDGLTAKVFRTYNASITLQEQLRAL 441 > At5g55300 Length=916 Score = 49.3 bits (116), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 20/27 (74%), Positives = 25/27 (92%), Gaps = 0/27 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQEL 30 HLK+L+PGL+AK+FRTYNASITL + L Sbjct 722 HLKELVPGLTAKVFRTYNASITLDEML 748 > 7293054 Length=974 Score = 47.0 bits (110), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQKL 33 HLK+LM GL+AK+FRTYNAS TLQ +L L Sbjct 800 HLKELMEGLTAKVFRTYNASKTLQSQLDLL 829 > At5g55310 Length=917 Score = 46.2 bits (108), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%), Gaps = 0/29 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQELQK 32 HLK+LM GL+AK+FRTYNASITL L K Sbjct 720 HLKELMAGLTAKVFRTYNASITLDLMLSK 748 > SPBC1703.14c Length=814 Score = 44.7 bits (104), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 23/41 (56%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Query 1 STN----HLKQLMPGLSAKMFRTYNASITLQQELQKLQPTL 37 STN +L LM GLSAK+FRTYNAS T+ +EL+K+ L Sbjct 543 STNSLNKYLTSLMDGLSAKVFRTYNASYTMAEELKKMPKNL 583 > CE12282 Length=806 Score = 44.3 bits (103), Expect = 5e-05, Method: Composition-based stats. Identities = 21/31 (67%), Positives = 27/31 (87%), Gaps = 0/31 (0%) Query 3 NHLKQLMPGLSAKMFRTYNASITLQQELQKL 33 +HL+ LM GL+ K+FRTYNASITLQ++L KL Sbjct 624 DHLRSLMDGLTVKVFRTYNASITLQEQLIKL 654 > CE12284 Length=734 Score = 44.3 bits (103), Expect = 6e-05, Method: Composition-based stats. Identities = 21/31 (67%), Positives = 27/31 (87%), Gaps = 0/31 (0%) Query 3 NHLKQLMPGLSAKMFRTYNASITLQQELQKL 33 +HL+ LM GL+ K+FRTYNASITLQ++L KL Sbjct 552 DHLRSLMDGLTVKVFRTYNASITLQEQLIKL 582 > YOL006c Length=769 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 17/27 (62%), Positives = 23/27 (85%), Gaps = 0/27 (0%) Query 4 HLKQLMPGLSAKMFRTYNASITLQQEL 30 +L+ MPGL+AK+FRTYNAS T+Q +L Sbjct 503 YLQNYMPGLTAKVFRTYNASKTMQDQL 529 > At5g52550 Length=197 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 28/41 (68%), Gaps = 0/41 (0%) Query 34 QPTLRKFKEEVEREGLKKVGKAKAKKVKEEPAAAAAAAATA 74 QP +RK +++ ERE L+++ +A+ KK + E + A +AA A Sbjct 12 QPIVRKARKKKEREELERIKQAERKKRRIEKSIATSAAIRA 52 Lambda K H 0.311 0.120 0.313 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1209785478 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40