bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2999_orf1 Length=105 Score E Sequences producing significant alignments: (Bits) Value SPBC4F6.17c 40.8 7e-04 SPBC16D10.08c 39.3 0.002 At2g25140 36.2 0.017 At1g74310 35.0 0.031 At5g15450 34.7 0.045 At2g25030 32.3 0.20 At5g17970 30.0 1.2 At5g51070 29.3 2.0 YDR258c 28.5 2.7 7302710 28.5 2.9 YOR288c 27.3 6.5 > SPBC4F6.17c Length=803 Score = 40.8 bits (94), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 0/47 (0%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDLGPDHEAIADWSTTEKKWK 48 PA+GARPL R ++K I++ +++ ++ G++ D + D E ++K Sbjct 744 PAYGARPLNRLIQKRILNTMAMKIIQGEIKSDENVVIDVLDGELEFK 790 > SPBC16D10.08c Length=905 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 17/57 (29%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDL-----------------GPDHEAIADWS 41 PA+GARPL R ++ +++ ++V++LNG L P+HEA A+ S Sbjct 831 PAYGARPLNRVIQNQVLNPMAVLILNGQLRDKETAHVVVQNGKIFVKPNHEANANGS 887 > At2g25140 Length=874 Score = 36.2 bits (82), Expect = 0.017, Method: Compositional matrix adjust. Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 0/54 (0%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDLGPDHEAIADWSTTEKKWKWRVTRLH 55 P +GARP+KR +++ + ++++V +L GD + + D K + +L Sbjct 811 PNYGARPVKRVIQQMVENEIAVGILKGDFAEEDTVLVDVDHLASDNKLVIKKLE 864 > At1g74310 Length=911 Score = 35.0 bits (79), Expect = 0.031, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 24/29 (82%), Gaps = 0/29 (0%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDL 30 P +GARP++R++EK +V++LS M++ ++ Sbjct 812 PVYGARPIRRWMEKKVVTELSKMVVREEI 840 > At5g15450 Length=968 Score = 34.7 bits (78), Expect = 0.045, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 0/42 (0%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDLGPDHEAIADWSTT 43 P +GARP+KR ++++I ++L+ +L GD + + D T Sbjct 894 PNYGARPVKRVIQQNIENELAKGILRGDFKEEDGILIDTEVT 935 > At2g25030 Length=265 Score = 32.3 bits (72), Expect = 0.20, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 0/49 (0%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDLGPDHEAIADWSTTEKKWKWR 50 P GARP+K+ +EK + ++++ +L GD D + D K + Sbjct 206 PNNGARPVKQMIEKLVKKEITLKVLKGDFAEDGTILIDADQPNNKLVIK 254 > At5g17970 Length=780 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Query 22 SVMLLNGDLGPDHEAIADWSTTEKKWKWR--VTRLHGVEGQAQNEMDADPSVEAGLPRSI 79 SV GD G + I D T E++ +WR +T + + G+ ++ D D + + + Sbjct 115 SVRKQTGDFGKAFDKICDVRTEEERQRWRQALTNVGNIAGECSSKWDNDAKMIEKIVAYV 174 Query 80 SE 81 SE Sbjct 175 SE 176 > At5g51070 Length=945 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 0/42 (0%) Query 2 PAFGARPLKRYLEKHIVSDLSVMLLNGDLGPDHEAIADWSTT 43 PA+GARPL+R + + + LS L G P A T Sbjct 881 PAYGARPLRRTVTEIVEDPLSEAFLAGSFKPGDTAFVVLDDT 922 > YDR258c Length=811 Score = 28.5 bits (62), Expect = 2.7, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 0/27 (0%) Query 4 FGARPLKRYLEKHIVSDLSVMLLNGDL 30 +GARPL R + + I++ ++ LL G + Sbjct 752 YGARPLNRLIHRQILNSMATFLLKGQI 778 > 7302710 Length=700 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query 33 DHEAIADWSTTEKKWKWRVTRLHG-VEGQAQNEMDAD 68 +H + + E KW+WR T L+ EG A N+M +D Sbjct 150 NHYLHSKYEKDEIKWRWRSTTLNPYYEGNAINQMISD 186 > YOR288c Length=318 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 0/36 (0%) Query 58 EGQAQNEMDADPSVEAGLPRSISESSRTSSYTGRSE 93 E +AQN D+DP + P+S ++ ++YT E Sbjct 18 EVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVE 53 Lambda K H 0.314 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1170944580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40