bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2760_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value YDR529c 55.8 4e-08 At5g25450 51.6 8e-07 7301665 47.4 2e-05 At4g32470 45.8 5e-05 7293193 40.0 0.002 CE23545 33.9 0.16 SPCC737.02c 33.5 0.23 7301343 31.2 1.1 At2g40360 30.4 2.1 At1g74430 30.4 2.1 YBL099w 30.0 2.6 > YDR529c Length=127 Score = 55.8 bits (133), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 41/112 (36%), Positives = 58/112 (51%), Gaps = 12/112 (10%) Query 18 FLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLA 77 LS+L PV +F N A K GL +DDL +++ P+++ AL LPED + Sbjct 20 VLSKLCVPVANQFI-------NLAGYKKL----GLKFDDLIAEENPIMQTALRRLPEDES 68 Query 78 TARYRRIMRATHLNHVRLYLPPNE-QNYDPFIPYLAPYVEEAKFQLQEEEEL 128 AR RI+RA LP NE +PYL PY+ EA+ +E++EL Sbjct 69 YARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDEL 120 > At5g25450 Length=122 Score = 51.6 bits (122), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 43/125 (34%), Positives = 61/125 (48%), Gaps = 13/125 (10%) Query 17 SFLSELLAPVWFRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPV----IERALELL 72 SFL L+ P + L R + ++ LR GL YDDLY +P+ I+ AL L Sbjct 3 SFLQRLVDPR-----KNFLARMHMKSVSNRLRRYGLRYDDLY---DPLYDLDIKEALNRL 54 Query 73 PEDLATARYRRIMRATHLNHVRLYLPPNEQNYD-PFIPYLAPYVEEAKFQLQEEEELLGY 131 P ++ AR +R+MRA L+ YLP N Q PF YL + K + E E L Sbjct 55 PREIVDARNQRLMRAMDLSMKHEYLPDNLQAVQTPFRSYLQDMLALVKRERAEREALGAL 114 Query 132 HMWER 136 +++R Sbjct 115 PLYQR 119 > 7301665 Length=111 Score = 47.4 bits (111), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 35/103 (33%), Positives = 49/103 (47%), Gaps = 8/103 (7%) Query 33 GPLDRW--NQAAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLATARYRRIMRATHL 90 L +W N + +Y GL DD + E V E A+ LP L R RI+RA HL Sbjct 14 SKLGKWAYNMSGFNQY----GLYRDDCLYENEDVAE-AVRRLPRKLYDERNYRILRALHL 68 Query 91 NHVRLYLPPNE-QNYDPFIPYLAPYVEEAKFQLQEEEELLGYH 132 + + LP + Y+ I YL PY+ E + + +E EE H Sbjct 69 SMTKTILPKEQWTKYEEDIKYLEPYLNEVQKEREEREEWSKTH 111 > At4g32470 Length=122 Score = 45.8 bits (107), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 2/106 (1%) Query 35 LDRWNQAAIGKYLREQGLMYDDLYSDKEPV-IERALELLPEDLATARYRRIMRATHLNHV 93 L R + AI LR GL YDDLY + I+ A+ LP ++ AR +R+ RA L+ Sbjct 16 LARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMK 75 Query 94 RLYLPPNEQNYD-PFIPYLAPYVEEAKFQLQEEEELLGYHMWERRL 138 YLP + Q PF YL + + + +E E L +++R L Sbjct 76 HEYLPKDLQAVQTPFRGYLQDMLALVERESKEREALGALPLYQRTL 121 > 7293193 Length=111 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 31/84 (36%), Positives = 41/84 (48%), Gaps = 8/84 (9%) Query 35 LDRW--NQAAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLATARYRRIMRATHLNH 92 L RW N + +Y GL DD + E V E A+ LP L R RIMRA HL+ Sbjct 16 LGRWAYNLSGFNQY----GLHRDDCLYENEDVKE-AVRRLPRKLYDERNYRIMRALHLSM 70 Query 93 VRLYLPPNE-QNYDPFIPYLAPYV 115 + LP + Y+ + YL PY+ Sbjct 71 TKTILPKEQWTKYEEDVKYLEPYL 94 > CE23545 Length=801 Score = 33.9 bits (76), Expect = 0.16, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 7/59 (11%) Query 28 FRFFRGPLDRWNQAAIGKYLREQGLMYDDLYSDKEPVIERALELLPEDLATARYRRIMR 86 F+ +G ++R+ Q GK L DD +K +IE+ALE+L E+ Y+++ R Sbjct 420 FKEVKGLVERFEQRLKGKEL-------DDEQKNKAKLIEKALEMLLENFDDTDYKKVER 471 > SPCC737.02c Length=137 Score = 33.5 bits (75), Expect = 0.23, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 5/77 (6%) Query 48 REQGLMYDDLYSDKEPVIERALELLPEDLATARYRRIMRATHLNHVRLYLPPN-----EQ 102 R+ GL YDDL ++ ++AL LP+ + R RI RA L+ LP + E+ Sbjct 34 RKYGLRYDDLMLEENDDTQKALSRLPKMESYDRVYRIRRAMQLSIENKILPKSEWTKPEE 93 Query 103 NYDPFIPYLAPYVEEAK 119 +Y P LA + E K Sbjct 94 DYHYLRPVLAEVIAERK 110 > 7301343 Length=1311 Score = 31.2 bits (69), Expect = 1.1, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Query 77 ATARYRRIMR-ATHLNHVRLYLPPNEQNYDPFIPYLAPYVEEAKFQLQEE--EELLGYHM 133 +T R R+M+ +H+ H L ++Y PYL P E + E ++L GY+M Sbjct 688 STERDLRLMKHRSHILHKLLEGCIQRRDYSVLAPYLPPKHEYVVYTTLSELQQKLYGYYM 747 Query 134 WERRLYSGG 142 R SGG Sbjct 748 TTHREQSGG 756 > At2g40360 Length=775 Score = 30.4 bits (67), Expect = 2.1, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query 86 RATHLNHV---RLYLPPNEQNYDPFIPYLAPYVEEAKFQLQEEEE 127 ++ HL ++ +L LP ++++Y+P + Y+ E+A ++L EE+ Sbjct 326 KSKHLTYIPPPKLKLPGHDESYNPSLEYIPTEEEKASYELMFEED 370 > At1g74430 Length=271 Score = 30.4 bits (67), Expect = 2.1, Method: Compositional matrix adjust. Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%) Query 107 FIPYLAPYVEEAKFQLQEEEELLGYH 132 ++ YL P ++ KF QEEEE++ YH Sbjct 57 WLNYLRPGIKRGKFTPQEEEEIIKYH 82 > YBL099w Length=545 Score = 30.0 bits (66), Expect = 2.6, Method: Composition-based stats. Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 28/93 (30%) Query 38 WNQAAIGKYLREQG----LMYDDLYSDKEPVIERALELLPEDLATARYRRIMRATHLNHV 93 + A+IG++ R+ G ++YDDL K+ V R L LL Sbjct 285 FTAASIGEWFRDNGKHALIVYDDL--SKQAVAYRQLSLL--------------------- 321 Query 94 RLYLPPNEQNYDPFIPYLAPYVEEAKFQLQEEE 126 L PP + Y + YL P + E +L E+E Sbjct 322 -LRRPPGREAYPGDVFYLHPRLLERAAKLSEKE 353 Lambda K H 0.322 0.141 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2806646388 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40