bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2564_orf3 Length=127 Score E Sequences producing significant alignments: (Bits) Value Hs8923930 43.1 1e-04 At5g51720 39.3 0.002 Hs22044166 39.3 0.002 7301766 36.6 0.011 CE03767_1 36.6 0.011 Hs17435381 31.6 0.37 CE02915 29.3 1.8 YMR259c 28.5 2.8 7292061 27.3 7.3 7304162 26.9 9.8 > Hs8923930 Length=108 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query 47 CRCWQSTKFPICDNAH-KVLQKQGCNCGPTMLEVRQ 81 CRCW+S KFP CD AH K ++ G N GP +++ ++ Sbjct 72 CRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107 > At5g51720 Length=108 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query 47 CRCWQSTKFPICDNAH-KVLQKQGCNCGPTMLE 78 CRCW+S FP+CD +H K + G N GP +L+ Sbjct 74 CRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLK 106 > Hs22044166 Length=547 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query 47 CRCWQSTKFPICDNAH-KVLQKQGCNCGPTMLEVRQ 81 C CW+ KFP CD +H K ++ G N GP ++E ++ Sbjct 511 CHCWRYKKFPFCDGSHTKHNEQTGDNVGPLIIEKKE 546 > 7301766 Length=133 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query 45 SICRCWQSTKFPICDNAHKVLQKQ-GCNCGPTMLE 78 + CRCW++ +P CD +H KQ G N GP +++ Sbjct 98 AFCRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIK 132 > CE03767_1 Length=148 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query 45 SICRCWQSTKFPICDNAHKVLQKQ-GCNCGPTMLE 78 + CRCW+S K+P CD +H K+ G N GP +++ Sbjct 96 AFCRCWKSEKWPYCDGSHGKHNKETGDNVGPLIVK 130 > Hs17435381 Length=141 Score = 31.6 bits (70), Expect = 0.37, Method: Compositional matrix adjust. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 9/50 (18%) Query 47 CRCWQSTKFPICDN-AHKVLQKQGCNCGPTMLEVRQAPSLTEPRDMNSSF 95 C CW+S KFP+CD +HK + C + E R++N F Sbjct 99 CHCWRSRKFPLCDGVSHKTQGRDWRQC--------ETSDHQEKRNLNGHF 140 > CE02915 Length=331 Score = 29.3 bits (64), Expect = 1.8, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 0/32 (0%) Query 59 DNAHKVLQKQGCNCGPTMLEVRQAPSLTEPRD 90 DN + V++K GC T +E+ Q S EP D Sbjct 19 DNKNDVIEKVGCGLHSTNVELAQTRSAQEPAD 50 > YMR259c Length=1420 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Query 46 ICRCWQSTKFPIC-DNAHKVLQKQGCNCG 73 + + W++T+ +C D+AH +L ++ NCG Sbjct 623 VLKSWEATRNVVCHDSAHGILPEKYANCG 651 > 7292061 Length=1057 Score = 27.3 bits (59), Expect = 7.3, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query 21 CSPADLPSVHTEVLYPTAKRTVNFSICRCWQ----STKFPICDNAHKVLQK 67 CSPAD+ S+ +L P VN + Q + F + +N KVL K Sbjct 505 CSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANAIFKLAENPRKVLNK 555 > 7304162 Length=568 Score = 26.9 bits (58), Expect = 9.8, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 20/48 (41%), Gaps = 0/48 (0%) Query 70 CNCGPTMLEVRQAPSLTEPRDMNSSFESKERMSAGALFGGAASVAAAV 117 C C T L Q + T +NSS K+ + GGA + ++ Sbjct 447 CTCNSTWLSTTQVQNQTRSTTINSSNRKKKNKAKTQTKGGAGGITGSL 494 Lambda K H 0.321 0.131 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1176738752 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40