bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2522_orf2 Length=75 Score E Sequences producing significant alignments: (Bits) Value At4g04950 50.1 1e-06 At3g15660 48.5 3e-06 SPAPB2B4.02 46.2 2e-05 Hs5730104 45.4 3e-05 At2g38270 44.3 5e-05 7298047 43.1 1e-04 CE22220 42.4 2e-04 SPBC26H8.06 40.8 6e-04 ECU05g1380 40.4 7e-04 7293005_2 40.0 0.001 YPL059w 39.3 0.002 At5g06470 36.6 0.013 YER174c 36.2 0.016 At5g01420 35.4 0.028 YDR098c 34.3 0.063 At5g13810 33.5 0.11 At3g54900 32.3 0.19 CE04353 32.3 0.23 At4g10630 32.0 0.28 At1g03020 31.6 0.37 CE26906 30.8 0.63 ECU09g1375 30.4 0.76 At5g03870 29.6 1.6 At1g32760 29.3 1.9 SPCC1450.06c 28.1 3.8 YDR513w 28.1 4.1 CE28366 27.3 6.3 At3g62930 27.3 6.5 CE01974 26.9 8.8 > At4g04950 Length=488 Score = 50.1 bits (118), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 0/60 (0%) Query 13 VKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFKGLSDSSSSSSSSGSGSGDGG 72 +K+ +WPTFP L G+++GGAD+ A+ + G+L FK L ++ S S +G GG Sbjct 211 LKKFSNWPTFPQLYCNGELLGGADIAIAMHESGELKDAFKDLGITTVGSKESQDEAGKGG 270 Score = 43.9 bits (102), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 0/43 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAA 49 +++ + +K +WPTFP L KG+++GG D++ L + G L A Sbjct 442 EEVRQGIKNFSNWPTFPQLYYKGELIGGCDIIMELSESGDLKA 484 Score = 35.8 bits (81), Expect = 0.019, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Query 18 DWPTFPLLVVKGKVVGGADVLQALQQQGQLAALF--KGLS 55 +W ++P L VKG+++GG+D++ +Q+ G+L + KG++ Sbjct 346 NWSSYPQLYVKGELMGGSDIVLEMQKSGELKKVLTEKGIT 385 > At3g15660 Length=169 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 0/49 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFKGLS 55 Q+L VK WPTFP + +KG+ +GG+D++ + ++G+L K +S Sbjct 117 QELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEQKLKDVS 165 > SPAPB2B4.02 Length=146 Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 0/48 (0%) Query 8 QLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFKGLS 55 +L +K DWPT P L + G+ VGG+D+L ++ + G+L + K ++ Sbjct 81 ELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKEIN 128 > Hs5730104 Length=335 Score = 45.4 bits (106), Expect = 3e-05, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 34/47 (72%), Gaps = 0/47 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFKG 53 +++ + +K +WPT+P L VKG++VGG D+++ L++ G+L + +G Sbjct 287 EEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRG 333 Score = 35.4 bits (80), Expect = 0.023, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 27/41 (65%), Gaps = 0/41 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQL 47 +++ + +K WPT+P L V G+++GG D+++ L+ +L Sbjct 185 EEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEEL 225 > At2g38270 Length=293 Score = 44.3 bits (103), Expect = 5e-05, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 0/43 (0%) Query 9 LGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALF 51 L +K +WPTFP + VKG++VGG D+L ++ + G+LA + Sbjct 250 LRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYENGELANIL 292 > 7298047 Length=216 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 31/47 (65%), Gaps = 0/47 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFKG 53 +++ + +K DWPT+P + VKG+++GG D+++ L +L + KG Sbjct 170 EEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLKG 216 > CE22220 Length=142 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALF--KGLSD 56 Q+L VK +WPT P + VKG+ VGG D+L ++ + G+++ KG+S+ Sbjct 86 QELREGVKIFSEWPTIPQVYVKGEFVGGCDILISMHKDGEISDFLDEKGISN 137 > SPBC26H8.06 Length=244 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Query 15 RVF-DWPTFPLLVVKGKVVGGADVLQALQQQGQLAALF 51 +VF DWPTFP L +KG+ VGG D++ + + G+L + Sbjct 205 KVFSDWPTFPQLYIKGEFVGGLDIVSEMIENGELQEML 242 > ECU05g1380 Length=204 Score = 40.4 bits (93), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 0/41 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQL 47 + + R +K + WPTFP + + G+ +GG DV++ + ++G+L Sbjct 156 EDVRRKLKEINSWPTFPQVYIGGRFIGGLDVVRKMSEKGEL 196 > 7293005_2 Length=116 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 13 VKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 VK DWPT P + + G+ VGG D+L + Q G L K Sbjct 55 VKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELK 94 > YPL059w Length=150 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 0/45 (0%) Query 8 QLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 +L +K +WPT P L V + +GG DV+ ++ + G+LA L + Sbjct 90 ELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLE 134 > At5g06470 Length=239 Score = 36.6 bits (83), Expect = 0.013, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 21 TFPLLVVKGKVVGGADVLQALQQQGQLAALFKGLSDSSSSSSS 63 T P L ++G+ +GGA+ + AL + G+L L +G+S S S Sbjct 146 TSPRLFIRGRYIGGAEEVVALNENGKLKKLLQGISQVDSPCES 188 > YER174c Length=244 Score = 36.2 bits (82), Expect = 0.016, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 5 RRQQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQ 39 R + + + +K+ DWPTFP L + G+ GG D+++ Sbjct 195 RDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIK 229 > At5g01420 Length=401 Score = 35.4 bits (80), Expect = 0.028, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 23 PLLVVKGKVVGGADVLQALQQQGQLAALFKGL 54 P+L VKG+ +GGA + L +QG+ LF+G+ Sbjct 317 PVLFVKGRCIGGAQRVLGLHEQGKFKILFEGI 348 > YDR098c Length=285 Score = 34.3 bits (77), Expect = 0.063, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 5 RRQQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQ 39 R + + + +K+ +WPTFP L + G+ GG D+++ Sbjct 235 RDESVRQNLKKFSEWPTFPQLYINGEFQGGLDIIK 269 > At5g13810 Length=274 Score = 33.5 bits (75), Expect = 0.11, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 21 TFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 + P + + GK VGGADV+++L + G+LA + K Sbjct 185 SLPQVFIMGKYVGGADVIKSLFEIGELAKILK 216 > At3g54900 Length=173 Score = 32.3 bits (72), Expect = 0.19, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 13 VKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQL 47 +K +WPTFP L + G+ GG D+ + G+L Sbjct 129 LKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGEL 163 > CE04353 Length=149 Score = 32.3 bits (72), Expect = 0.23, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 0/46 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 +++ +K+ T P L + GK VGG D +A++++G+L L + Sbjct 87 EEMQEILKKYSGRTTVPQLFISGKFVGGHDETKAIEEKGELRPLLE 132 > At4g10630 Length=334 Score = 32.0 bits (71), Expect = 0.28, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 0/50 (0%) Query 23 PLLVVKGKVVGGADVLQALQQQGQLAALFKGLSDSSSSSSSSGSGSGDGG 72 P + VKG+ +GG + + L ++G L G+ + SG+ G GG Sbjct 242 PRVFVKGRYIGGGEEVLRLVEEGSFGELISGIPRKKAGGCESGACDGCGG 291 > At1g03020 Length=102 Score = 31.6 bits (70), Expect = 0.37, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 0/33 (0%) Query 20 PTFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 PT P + + ++VGGA+ L +LQ + QLA+L + Sbjct 63 PTVPAVFIGQELVGGANQLMSLQVRNQLASLLR 95 > CE26906 Length=665 Score = 30.8 bits (68), Expect = 0.63, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Query 5 RRQQLGRCVKRVFDWPT----FPLLVVKGKVVGGADVLQALQQ 43 ++ Q+ R ++V + T +PL+ +KG VGG L+AL+Q Sbjct 119 KKLQVSRASQKVIQYLTLHTSWPLMYIKGNAVGGLKELKALKQ 161 > ECU09g1375 Length=98 Score = 30.4 bits (67), Expect = 0.76, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 0/45 (0%) Query 7 QQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQLAALF 51 ++L + ++R + + TFP + +K K VGGA L+ ++ + F Sbjct 49 ERLSKEIEREYGFSTFPKIFLKRKFVGGASDLKEYVKKKEFLDAF 93 > At5g03870 Length=384 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 23 PLLVVKGKVVGGADVLQALQQQGQLAALFKGL 54 P + VKG++VG + + L+++G+L L +G+ Sbjct 297 PAVFVKGRMVGSVEEVMRLEEEGKLGILLEGI 328 > At1g32760 Length=314 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 23 PLLVVKGKVVGGADVLQALQQQGQLAALFK 52 P + VKGK +GGA+ + L ++G L L K Sbjct 224 PRVFVKGKYIGGAEEVMRLVEEGLLGELLK 253 > SPCC1450.06c Length=166 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 0/44 (0%) Query 4 QRRQQLGRCVKRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQL 47 + Q+L + + D T P + V G +GG+D ++AL Q+ +L Sbjct 105 EHTQELRDWLSSISDISTMPNIFVGGHSIGGSDSVRALYQEEKL 148 > YDR513w Length=143 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 21 TFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 T P + + GK +GG L+ L++ G+LA + K Sbjct 108 TVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139 > CE28366 Length=433 Score = 27.3 bits (59), Expect = 6.3, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query 14 KRVFDWPTFPLLVVKGKVVGGADVLQALQQQGQL-AALFKGLSDSSSSSSSSGSG 67 K+ D P + L++V G +VG A Q L ++ QL AL + + + S SG Sbjct 18 KKSVDLPKYDLVIVGGGIVGCATARQLLIEKPQLKVALIEKEKELAVHQSGHNSG 72 > At3g62930 Length=102 Score = 27.3 bits (59), Expect = 6.5, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 20 PTFPLLVVKGKVVGGADVLQALQQQGQLAALFK 52 P+ P + + + +GGA+ + LQ + QLAA+ + Sbjct 63 PSVPAVFIGQQFIGGANQVMTLQVKNQLAAMLR 95 > CE01974 Length=204 Score = 26.9 bits (58), Expect = 8.8, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 0/37 (0%) Query 18 DWPTFPLLVVKGKVVGGADVLQALQQQGQLAALFKGL 54 DW F L+V K + + GA+ +Q + LAAL++GL Sbjct 47 DWGDFYLVVKKVRDIYGAESVQTGFAKKSLAALWEGL 83 Lambda K H 0.312 0.129 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181410888 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40