bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2421_orf2 Length=135 Score E Sequences producing significant alignments: (Bits) Value At2g04030 51.2 5e-07 At3g07770 49.7 2e-06 At4g24190 47.8 6e-06 CE06362 46.2 2e-05 YMR186w 43.5 1e-04 YPL240c 43.5 1e-04 Hs7706485 42.4 2e-04 ECU02g1100 40.4 0.001 Hs22041160 40.0 0.001 CE29455 39.7 0.002 Hs13129150 39.3 0.002 Hs4507677 39.3 0.002 7292327 39.3 0.002 SPAC926.04c 39.3 0.002 Hs22065017 38.9 0.002 7302271 38.5 0.003 CE05441 37.7 0.005 At5g56030 37.7 0.006 At5g56010 37.7 0.006 At5g56000 37.7 0.006 At5g52640 37.7 0.006 7301648 37.4 0.009 Hs20149594 37.0 0.009 CE00571 35.0 0.042 YLL061w 32.3 0.27 At3g46960 31.6 0.41 > At2g04030 Length=780 Score = 51.2 bits (121), Expect = 5e-07, Method: Composition-based stats. Identities = 24/42 (57%), Positives = 31/42 (73%), Gaps = 0/42 (0%) Query 94 AELAKLRADAEGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 A +A+ EG E EYQAEV+RL+D+IV+SLYS +EVFL Sbjct 63 AAVAEKETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFL 104 > At3g07770 Length=803 Score = 49.7 bits (117), Expect = 2e-06, Method: Composition-based stats. Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 E EYQAEV+RLMD+IVNSLYS +EVFL Sbjct 95 EKFEYQAEVSRLMDLIVNSLYSNKEVFL 122 > At4g24190 Length=823 Score = 47.8 bits (112), Expect = 6e-06, Method: Composition-based stats. Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 4/37 (10%) Query 99 LRADAEGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 LR++AE E+QAEV+RLMDII+NSLYS +++FL Sbjct 72 LRSNAE----KFEFQAEVSRLMDIIINSLYSNKDIFL 104 > CE06362 Length=760 Score = 46.2 bits (108), Expect = 2e-05, Method: Composition-based stats. Identities = 20/43 (46%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Query 93 LAELAKLRADAEGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ++++ +LR+ AE HE+QAEV R+M +I+NSLY +E+FL Sbjct 51 VSQIKELRSKAE----KHEFQAEVNRMMKLIINSLYRNKEIFL 89 > YMR186w Length=705 Score = 43.5 bits (101), Expect = 1e-04, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET E+QAE+T+LM +I+N++YS +E+FL Sbjct 4 ETFEFQAEITQLMSLIINTVYSNKEIFL 31 > YPL240c Length=709 Score = 43.5 bits (101), Expect = 1e-04, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 25/28 (89%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET E+QAE+T+LM +I+N++YS +E+FL Sbjct 4 ETFEFQAEITQLMSLIINTVYSNKEIFL 31 > Hs7706485 Length=704 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 0/44 (0%) Query 92 PLAELAKLRADAEGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 PL + +G HE+QAE +L+DI+ SLYS++EVF+ Sbjct 70 PLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFI 113 > ECU02g1100 Length=690 Score = 40.4 bits (93), Expect = 0.001, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 4/46 (8%) Query 90 QGPLAELAKLRADAEGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 Q PL E K++ + H ETH ++ +V ++MD ++ S+YS +E+FL Sbjct 5 QEPLVE-GKIK---DKHSETHGFEVDVNQMMDTMIKSVYSSKELFL 46 > Hs22041160 Length=343 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 104 EGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 E ET +QAE+ +LM +I+N+ YS +E+FL Sbjct 9 EKEVETFAFQAEIAQLMSLIINTFYSNKEIFL 40 > CE29455 Length=657 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 + HE+QAE LMDI+ SLYS EVF+ Sbjct 28 QRHEFQAETRNLMDIVAKSLYSHSEVFV 55 > Hs13129150 Length=732 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 104 EGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 E ET +QAE+ +LM +I+N+ YS +E+FL Sbjct 14 EEEVETFAFQAEIAQLMSLIINTFYSNKEIFL 45 > Hs4507677 Length=803 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 E +QAEV R+M +I+NSLY +E+FL Sbjct 74 EKFAFQAEVNRMMKLIINSLYKNKEIFL 101 > 7292327 Length=717 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +LM +I+N+ YS +E+FL Sbjct 6 ETFAFQAEIAQLMSLIINTFYSNKEIFL 33 > SPAC926.04c Length=704 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 25/28 (89%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +++AE+++LM +I+N++YS +E+FL Sbjct 5 ETFKFEAEISQLMSLIINTVYSNKEIFL 32 > Hs22065017 Length=343 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +LM +I+N+ YS +E+FL Sbjct 18 ETFAFQAEIAQLMSLIINTFYSNKEIFL 45 > 7302271 Length=691 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 15/28 (53%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 + HE+QAE +L+DI+ SLYS EVF+ Sbjct 64 DKHEFQAETRQLLDIVARSLYSDHEVFV 91 > CE05441 Length=702 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +LM +I+N+ YS +E++L Sbjct 6 ETFAFQAEIAQLMSLIINTFYSNKEIYL 33 > At5g56030 Length=699 Score = 37.7 bits (86), Expect = 0.006, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +L+ +I+N+ YS +E+FL Sbjct 5 ETFAFQAEINQLLSLIINTFYSNKEIFL 32 > At5g56010 Length=699 Score = 37.7 bits (86), Expect = 0.006, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +L+ +I+N+ YS +E+FL Sbjct 5 ETFAFQAEINQLLSLIINTFYSNKEIFL 32 > At5g56000 Length=699 Score = 37.7 bits (86), Expect = 0.006, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +L+ +I+N+ YS +E+FL Sbjct 5 ETFAFQAEINQLLSLIINTFYSNKEIFL 32 > At5g52640 Length=705 Score = 37.7 bits (86), Expect = 0.006, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 108 ETHEYQAEVTRLMDIIVNSLYSQREVFL 135 ET +QAE+ +L+ +I+N+ YS +E+FL Sbjct 10 ETFAFQAEINQLLSLIINTFYSNKEIFL 37 > 7301648 Length=787 Score = 37.4 bits (85), Expect = 0.009, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Query 93 LAELAKLRADAEGHQETHEYQAEVTRLMDIIVNSLYSQREVFL 135 +A+L ++R A+ +Q EV R+M +I+NSLY +E+FL Sbjct 62 VAQLKEIREKAK----KFTFQTEVNRMMKLIINSLYRNKEIFL 100 > Hs20149594 Length=724 Score = 37.0 bits (84), Expect = 0.009, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 21/27 (77%), Gaps = 0/27 (0%) Query 109 THEYQAEVTRLMDIIVNSLYSQREVFL 135 T +QAE+ +LM +I+N+ YS +E+FL Sbjct 14 TFAFQAEIAQLMSLIINTFYSNKEIFL 40 > CE00571 Length=322 Score = 35.0 bits (79), Expect = 0.042, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 7/46 (15%) Query 86 QGAPQGPLAELAKLRADAEGHQETHEYQAEVTR-------LMDIIV 124 QGA Q PL E A++R D GHQ + E R LMDI V Sbjct 250 QGAAQSPLDEFARMRIDEGGHQLRTNQETETNRQNQSQQPLMDINV 295 > YLL061w Length=583 Score = 32.3 bits (72), Expect = 0.27, Method: Compositional matrix adjust. Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Query 19 SSSSRRSAATVSSILKMALWRVVPFCFLGLLLLRCSA-AADPAGASDAAAAEPAAAPAAA 77 +S+ RS ++VS K WR++ F + ++++ C DP S +++ + A+P Sbjct 283 TSTEARSVSSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVI 342 Query 78 AAAAEGA 84 A + GA Sbjct 343 ALSNTGA 349 > At3g46960 Length=1347 Score = 31.6 bits (70), Expect = 0.41, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Query 10 SSCGGSSSSSSSSRRSAAT-----VSSILKMALWRVVPFCFLGLLLLRCSAA 56 SS G+S ++ + RRSAA+ ++ + KM+L VV FCF RC+ A Sbjct 608 SSYSGNSQNNGAFRRSAASNWLLLINKLSKMSLLPVVVFCFSKNYCDRCADA 659 Lambda K H 0.313 0.122 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1388795348 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40