bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2230_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value At4g25730 40.8 0.001 YCL054w 39.3 0.004 Hs17017991 38.9 0.006 7293173 35.4 0.070 SPAC1687.11 34.7 0.12 CE23795 33.9 0.19 CE23796 33.5 0.22 YML072c 30.0 2.4 > At4g25730 Length=821 Score = 40.8 bits (94), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Query 49 SETGLSPEAYTELILK-NKLTTKEIKELWEDLKVLNKKDLRTLLLWRWKVKRQI 101 + T +S + L LK + LTT+EIK L +DL VL K D + +L WR ++++ + Sbjct 272 TTTSISFDDQASLPLKEHDLTTEEIKILCDDLPVLGKNDFKHILKWRMQIRKAL 325 > YCL054w Length=841 Score = 39.3 bits (90), Expect = 0.004, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 26/120 (21%) Query 62 ILKN-KLTTKEIKELWEDLKVLNKKDLRTLLLWRWKVKRQIEATLRSSSSSSSSSGSGDG 120 ILK K TT E + EDLKVL KKD + +L WR K+ R+I Sbjct 289 ILKKLKQTTDEFRSCIEDLKVLGKKDFKMILRWR-KIAREIL------------------ 329 Query 121 SGEAVDGVEGRETAAAAAAAAAAAEDENEQADAELLHCMHRVSKLRRQQRKQQRQQQQQQ 180 G+E ++ A E+E + D + L R++ R ++RK + +Q++ Q Sbjct 330 ------GIEVKDDAKTEIEVVPLTEEEQIEKDLQGLQEKQRLNVKRERRRKNEMKQKELQ 383 > Hs17017991 Length=847 Score = 38.9 bits (89), Expect = 0.006, Method: Compositional matrix adjust. Identities = 16/39 (41%), Positives = 29/39 (74%), Gaps = 0/39 (0%) Query 68 TTKEIKELWEDLKVLNKKDLRTLLLWRWKVKRQIEATLR 106 TT++I+ +D++VL +K+LR+LL WR K++R + L+ Sbjct 286 TTEDIRVCCQDIRVLGRKELRSLLNWRTKLRRYVAKKLK 324 > 7293173 Length=817 Score = 35.4 bits (80), Expect = 0.070, Method: Compositional matrix adjust. Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Query 62 ILKNKLTTKEIKELWEDLKVLNKKDLRTLLLWRWKVKRQI 101 I +K TT EI E +DLKVL +KD++ L+ W WK R++ Sbjct 283 IANHKKTTPEILECCKDLKVLGRKDIKGLVQW-WKDVREL 321 > SPAC1687.11 Length=802 Score = 34.7 bits (78), Expect = 0.12, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 0/35 (0%) Query 67 LTTKEIKELWEDLKVLNKKDLRTLLLWRWKVKRQI 101 +TT+EI DL+VL KK+ R +L WR K++ ++ Sbjct 294 VTTEEILLCCSDLQVLGKKEFRDILRWRLKIRDEM 328 > CE23795 Length=833 Score = 33.9 bits (76), Expect = 0.19, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 68 TTKEIKELWEDLKVLNKKDLRTLLLWR 94 TT+E+ E D+KVL ++LR LL WR Sbjct 291 TTEEVIEYMNDVKVLGPRELRVLLRWR 317 > CE23796 Length=719 Score = 33.5 bits (75), Expect = 0.22, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 68 TTKEIKELWEDLKVLNKKDLRTLLLWR 94 TT+E+ E D+KVL ++LR LL WR Sbjct 291 TTEEVIEYMNDVKVLGPRELRVLLRWR 317 > YML072c Length=1545 Score = 30.0 bits (66), Expect = 2.4, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%) Query 23 KEDKSEKEAAAAAAAAAKGEKQQQN 47 KEDKSE++A A A AKG+K+ +N Sbjct 619 KEDKSEEKAVERAEAKAKGKKEDEN 643 Lambda K H 0.300 0.115 0.293 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2806646388 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40