bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2227_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value CE29195 36.2 0.017 SPAC694.02 33.9 0.079 ECU05g0940 32.3 0.25 At3g19870 30.0 0.97 Hs8923038 30.0 1.2 CE00803 29.6 1.6 Hs20537682 28.9 2.7 At4g17350 26.9 8.4 > CE29195 Length=1714 Score = 36.2 bits (82), Expect = 0.017, Method: Compositional matrix adjust. Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 10/86 (11%) Query 6 YFYLPLLSSSSSNH---PAPSWPNKDSKNASSRRTTELLAANSYLSDLYVHGKLARVASE 62 + PL S + P + KD + +R N++ D YVHG + Sbjct 1601 FLVAPLFDQYSHDESFLPVIDFNKKDHRGRKIQR-------NAFAYDFYVHGSRNMLMDV 1653 Query 63 NGVPPEQLWLLLQHFVLSLSRLSKGL 88 NG+ W LL F L RL+ G+ Sbjct 1654 NGLHVSVAWFLLHDFAAILERLAIGV 1679 > SPAC694.02 Length=1717 Score = 33.9 bits (76), Expect = 0.079, Method: Compositional matrix adjust. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 0/41 (0%) Query 44 NSYLSDLYVHGKLARVASENGVPPEQLWLLLQHFVLSLSRL 84 N+YL D + HG + + +N + ++W +L F L L+ + Sbjct 1587 NAYLLDFFTHGSVDMLIEQNNLKQSEIWFVLNDFSLVLATI 1627 > ECU05g0940 Length=1337 Score = 32.3 bits (72), Expect = 0.25, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Query 44 NSYLSDLYVHGKLARVASENGVPPEQLW---LLLQHFVLSLSRL 84 NSYL D + HG +R+A+EN V +L+ ++ VLSL +L Sbjct 1264 NSYLLDFFRHGSWSRIAAENRVGTGELFKSLSVVNSVVLSLIKL 1307 > At3g19870 Length=1117 Score = 30.0 bits (66), Expect = 0.97, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Query 58 RVASENGVPPEQLWLLLQHFVLSLSR---LSKGLLLLQQQQQQQGGC 101 R+A + +PP +L LL FV+SL L GL L Q + G C Sbjct 540 RIAENDTIPPSRLIELLTKFVISLVEKRGLDVGLKLWDQGTEVLGIC 586 > Hs8923038 Length=391 Score = 30.0 bits (66), Expect = 1.2, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 0/48 (0%) Query 41 LAANSYLSDLYVHGKLARVASENGVPPEQLWLLLQHFVLSLSRLSKGL 88 ++ N+Y D Y HG L + +N + + LL+ F L++ +S L Sbjct 315 MSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSL 362 > CE00803 Length=222 Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 9/63 (14%) Query 22 PSWPNKDSKNASSRRTTELLAANSYLSDLYVHGKLARVASENGVP-----PEQLWLLLQH 76 P W KD S R ++ L A L+ L+V G +A E+ VP P+++ LQH Sbjct 60 PHWKTKD---FPSSRISQHLVATMNLNSLFVAGGFGDLAVEDAVPSATGDPKKV-SHLQH 115 Query 77 FVL 79 F L Sbjct 116 FGL 118 > Hs20537682 Length=653 Score = 28.9 bits (63), Expect = 2.7, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query 40 LLAANSYLSDLYVHGKLARVASENGVPPEQLWLLLQHFVLSLSRLSKGL 88 LLA N + S+ V KL R AS +GVPP + L Q L S++ L Sbjct 602 LLAGN-HSSEPKVSCKLGRSASTSGVPPPSVTPLRQSSDLQQSQVPSSL 649 > At4g17350 Length=383 Score = 26.9 bits (58), Expect = 8.4, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 0/34 (0%) Query 65 VPPEQLWLLLQHFVLSLSRLSKGLLLLQQQQQQQ 98 P E + L + + LS S +SK L L +QQQ Q Sbjct 24 TPKEPMEFLSRSWSLSTSEISKALALKHRQQQDQ 57 Lambda K H 0.317 0.130 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1198419392 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40