bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2128_orf1 Length=91 Score E Sequences producing significant alignments: (Bits) Value 7292439 52.0 3e-07 Hs4506487 49.7 1e-06 CE17139 47.8 4e-06 At1g63160 47.4 7e-06 YOL094c 43.9 7e-05 SPAC1687.03c 41.2 5e-04 At5g53540 28.5 3.2 At5g10240 28.1 4.4 Hs21040271 27.7 5.9 7293437 27.3 7.1 > 7292439 Length=331 Score = 52.0 bits (123), Expect = 3e-07, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Query 20 LGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 LGY+P D++ V +R + + EHL L+F+ +G+THM + G+++ LQ+ +LA+LC Sbjct 268 LGYSPEDIIANIFRVCKRIN--IDEHLKLDFIREIGITHMKIIDGINSLLQLTALLAKLC 325 Query 80 KVA 82 A Sbjct 326 IAA 328 > Hs4506487 Length=354 Score = 49.7 bits (117), Expect = 1e-06, Method: Composition-based stats. Identities = 24/61 (39%), Positives = 40/61 (65%), Gaps = 2/61 (3%) Query 20 LGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 LGY+P D++ V + ++ E+L LEF+ +G THM +A G+++ LQM +LA+LC Sbjct 288 LGYSPEDIIGNIFRVCKTF--QMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLC 345 Query 80 K 80 + Sbjct 346 Q 346 > CE17139 Length=334 Score = 47.8 bits (112), Expect = 4e-06, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Query 5 RVWYGAQSVARVILSLGYTPLDVVTTFRGVLRRAD--SELQEHLLLEFLGIVGMTHMTMA 62 R ++ A + LG++ D+V+T V++ + + E L +E++ + M HM + Sbjct 247 RKFFEASKIIHEFHRLGFSSDDIVSTLFRVVKTVELSKNVSEQLRMEYIRQIAMCHMRIV 306 Query 63 GGLSTELQMEKMLAQLCKV 81 GL+++LQ+ +++A LC+V Sbjct 307 QGLTSKLQLSRLIADLCRV 325 > At1g63160 Length=333 Score = 47.4 bits (111), Expect = 7e-06, Method: Composition-based stats. Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Query 17 ILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLA 76 + LGY+P D++TT +++ D + E+L LEF+ G HM + G+ + LQ+ +LA Sbjct 264 LYDLGYSPTDIITTLFRIIKNYD--MAEYLKLEFMKETGFAHMRICDGVGSYLQLCGLLA 321 Query 77 QLCKV 81 +L V Sbjct 322 KLSIV 326 > YOL094c Length=323 Score = 43.9 bits (102), Expect = 7e-05, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Query 21 GYTPLDVVTT-FRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLAQLC 79 GY+ +D+VTT FR + + ++++E + LE + +G+THM + G+ T LQ+ MLA++ Sbjct 260 GYSSIDIVTTSFR--VTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIH 317 Query 80 KV 81 K+ Sbjct 318 KL 319 > SPAC1687.03c Length=342 Score = 41.2 bits (95), Expect = 5e-04, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query 17 ILSLGYTPLDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKMLA 76 I LG++ +D+VT V++ DS + E LE L +G THM + G+ T LQ+ ++ Sbjct 270 IWDLGFSAVDIVTNMFRVVKTMDS-IPEFSRLEMLKEIGQTHMIILEGVQTLLQLSGLVC 328 Query 77 QLCK 80 +L K Sbjct 329 RLAK 332 > At5g53540 Length=403 Score = 28.5 bits (62), Expect = 3.2, Method: Composition-based stats. Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 20/89 (22%) Query 7 WYG-AQSVARVILSLGYT--P----LDVVTTFRGVLRRADSELQEHLLLEFLGIVGMTHM 59 W+G AQ + + SL Y P +D V +F G R D+E ++ EF M Sbjct 162 WFGDAQKLVSAVFSLAYKLQPAIIFIDEVDSFLGQRRSTDNEAMSNMKTEF--------M 213 Query 60 TMAGGLSTELQMEKMLAQLCKVAISFRPS 88 + G +T+ M+ +A + RPS Sbjct 214 ALWDGFTTDQNARVMV-----LAATNRPS 237 > At5g10240 Length=578 Score = 28.1 bits (61), Expect = 4.4, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query 3 GFRVWYGAQSVARVILSLGYTPLDVVTTF-RGVLRRADSELQEHLLL 48 G R WY + V+ S Y PL V TF + V++R +++ +LL Sbjct 186 GLRRWYNPPWFSEVVPSTPYDPLVVRNTFEKAVIKRLMTDVPFGVLL 232 > Hs21040271 Length=980 Score = 27.7 bits (60), Expect = 5.9, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 0/33 (0%) Query 48 LEFLGIVGMTHMTMAGGLSTELQMEKMLAQLCK 80 L F+G +TH+T+AG + E M ML L + Sbjct 725 LAFIGKKTLTHLTLAGHIEWERTMMLMLCDLLR 757 > 7293437 Length=161 Score = 27.3 bits (59), Expect = 7.1, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 0/39 (0%) Query 37 RADSELQEHLLLEFLGIVGMTHMTMAGGLSTELQMEKML 75 R S Q L F+GI G M M G+ ELQ+E ++ Sbjct 113 RTSSPTQTLDFLIFIGIPGDVEMAMEMGMDMELQIEMVM 151 Lambda K H 0.326 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174483934 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40