bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2034_orf2 Length=78 Score E Sequences producing significant alignments: (Bits) Value At1g51650 47.8 5e-06 7293142 39.3 0.002 7299301 35.8 0.020 CE00285B 32.0 0.29 CE00285A 32.0 0.29 CE09866 31.2 0.54 ECU06g0660 30.0 1.1 SPBC31F10.15c 29.3 1.9 YPL271w 29.3 2.1 7295834 27.7 4.8 At1g47510 27.7 4.8 > At1g51650 Length=70 Score = 47.8 bits (112), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 0/52 (0%) Query 1 ASTMIWKTCGITYVRYAAEMADLLRKCIKEPYRTQLQNRNRVHFKETIYKQG 52 A+ W+ G+TY+ Y+ A+++R C+KEP++ + R +VHF + + G Sbjct 5 AAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADG 56 > 7293142 Length=61 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 0/54 (0%) Query 6 WKTCGITYVRYAAEMADLLRKCIKEPYRTQLQNRNRVHFKETIYKQGAVVSRET 59 W+ GITY++Y+ A +LR+ +K R R+ H K T + G R+T Sbjct 4 WRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQT 57 > 7299301 Length=64 Score = 35.8 bits (81), Expect = 0.020, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 0/57 (0%) Query 6 WKTCGITYVRYAAEMADLLRKCIKEPYRTQLQNRNRVHFKETIYKQGAVVSRETYDK 62 W+ GITY++Y+ A ++R+ ++ R RN H K T + G V R+ ++ Sbjct 4 WRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNGKPVPRKKVER 60 > CE00285B Length=54 Score = 32.0 bits (71), Expect = 0.29, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query 6 WKTCGITYVRYAAEMADLLRKCIKEPYRTQLQNRNRVHFKETIYKQGAVVSRE 58 W+ G+ YVRY+ A ++R+C K + + + K T ++ G +VS+ Sbjct 4 WRAAGLNYVRYSQIAAQVVRQCTKGGANVK---KPQATLKTTAWENGKMVSKS 53 > CE00285A Length=54 Score = 32.0 bits (71), Expect = 0.29, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query 6 WKTCGITYVRYAAEMADLLRKCIKEPYRTQLQNRNRVHFKETIYKQGAVVSRE 58 W+ G+ YVRY+ A ++R+C K + + + K T ++ G +VS+ Sbjct 4 WRAAGLNYVRYSQIAAQVVRQCTKGGANVK---KPQATLKTTAWENGKMVSKS 53 > CE09866 Length=54 Score = 31.2 bits (69), Expect = 0.54, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 6 WKTCGITYVRYAAEMADLLRKCIKE 30 W+ G+ YVRY+ A++ RKC K+ Sbjct 4 WRAAGLNYVRYSQIAAEITRKCTKQ 28 > ECU06g0660 Length=738 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 36 LQNRNRVHFKETIYKQGAVVSRETYDKLKAAFEAC 70 + NR +++ E I + VVS++ YD+ AA C Sbjct 702 MHNRYKLYLYECIKENAGVVSKDRYDETMAAVNKC 736 > SPBC31F10.15c Length=67 Score = 29.3 bits (64), Expect = 1.9, Method: Compositional matrix adjust. Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query 6 WKTCGITYVRYAAEMADLLRKCIKEPYRTQLQNRNRVHFKETIYKQGAVVSRETYDKLKA 65 WK +Y +YA+ + +R+ +K + +++ F T +K GA E+Y+ K+ Sbjct 5 WKK-NFSYSKYASICSQTVRQALKPEIKNEVKTHGDAEFLYTRWKNGAQEKTESYNSAKS 63 Query 66 A 66 A Sbjct 64 A 64 > YPL271w Length=62 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query 6 WKTCGITYVRYAAEMADLLRKCIKEPYRT-QLQNRNRVHFKETIYKQGAVVSRET 59 W+ GI+Y Y A +R +K +T + NR++ T YK G S T Sbjct 4 WRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPT 58 > 7295834 Length=184 Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query 10 GITYVRYAAEMADLLRKCIKE-PYRTQLQNRNRVHFKETIYK 50 G VR A MA C K P+R++ + NRVH E +K Sbjct 28 GSECVRSGARMAYKCSHCSKSFPHRSRFEEHNRVHTGERPFK 69 > At1g47510 Length=331 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query 50 KQGAVVSRETYDKLKAAFEAC--SGTAKKAD 78 K+GAV R YD +K F +C S AKK D Sbjct 151 KKGAVAIRINYDDIKMVFISCHLSAHAKKVD 181 Lambda K H 0.320 0.129 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40