bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1924_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value 7302348 44.3 5e-05 At1g01210 40.0 0.001 At4g07950 39.7 0.001 ECU03g0490 39.7 0.001 Hs7706499 39.3 0.002 SPAC22A12.05 34.7 0.046 YGL070c 33.5 0.096 YDR045c 33.1 0.14 Hs16975496 32.3 0.21 At3g02540 27.7 5.1 At1g31630 27.3 7.2 Hs22042372 27.3 7.7 > 7302348 Length=108 Score = 44.3 bits (103), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVARK 101 M FCP+C N+L++ D F C TCPYI I++K++ K Sbjct 1 MLFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTK 41 > At1g01210 Length=106 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 65 FCPTCHNMLLLRRDAEMEFYCRTCPYIYAIKKKVARK 101 FCPTC N+L F+C TCPY+ I+++V K Sbjct 3 FCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIK 39 > At4g07950 Length=106 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 65 FCPTCHNMLLLRRDAEMEFYCRTCPYIYAIKKKVARK 101 FCPTC N+L F+C TCPY+ I+++V K Sbjct 3 FCPTCGNLLRYEGGGSSRFFCSTCPYVANIERRVEIK 39 > ECU03g0490 Length=104 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Query 64 LFCPTCHNMLLLRRDA-EMEFYCRTCPYIYAIKKKVARKI 102 LFCP C +ML++++ A E C+ C Y+YAI ++++R + Sbjct 2 LFCPLCSSMLVVKKQAIGNELSCKMCGYLYAISEEISRTV 41 > Hs7706499 Length=108 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 62 MALFCPTCHNMLLLRRDAE-MEFYCRTCPYIYAIKKKVARK 101 M LFCP C N L++ F C TCPY++ I +KV + Sbjct 1 MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNR 41 > SPAC22A12.05 Length=109 Score = 34.7 bits (78), Expect = 0.046, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Query 65 FCPTCHNMLLLRRDAEME--FYCRTCPYIYAI 94 FCPTC N L++ D E F CRTCPY + I Sbjct 3 FCPTCGNHLIVAVDEEGRNAFDCRTCPYHFPI 34 > YGL070c Length=122 Score = 33.5 bits (75), Expect = 0.096, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Query 65 FCPTCHNMLLLRRDAEME---FYCRTCPYI 91 FC C+NML R D E F CRTC Y+ Sbjct 6 FCRDCNNMLYPREDKENNRLLFECRTCSYV 35 > YDR045c Length=110 Score = 33.1 bits (74), Expect = 0.14, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 11/50 (22%) Query 62 MALFCPTCHNMLLLRRDAEMEFY---CRTCPYIYAI-------KKKVARK 101 M FCP+C+NMLL+ + Y CR+CPY + I +KK+ RK Sbjct 1 MLSFCPSCNNMLLITS-GDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRK 49 > Hs16975496 Length=1663 Score = 32.3 bits (72), Expect = 0.21, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 0/56 (0%) Query 17 FAAPPASSSSSSSPLPASTPRPAAPAAAAPAAAAPAAAAAAGAAAMALFCPTCHNM 72 F P A+ + P STP P + P+ AAP A G A P H++ Sbjct 373 FPPPSANKIEENGPSTGSTPDPTSSTPPLPSNAAPPTAQTPGIAPQNSQAPPMHSL 428 > At3g02540 Length=419 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 18 AAPPASSSSSSSPLPASTPRPAAPAAAAPAA 48 A PPAS+ ++P PA T +PAA A+ P A Sbjct 239 ARPPASAGQPANP-PAQTQQPAAAPASGPNA 268 > At1g31630 Length=339 Score = 27.3 bits (59), Expect = 7.2, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 0/26 (0%) Query 39 AAPAAAAPAAAAPAAAAAAGAAAMAL 64 AAP A A A A+P A A GAA +A+ Sbjct 191 AAPLAVAGAGASPLAVAGVGAAPLAV 216 Score = 27.3 bits (59), Expect = 8.0, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Query 22 ASSSSSSSPLPASTPRPAA-----PAAAAPAAAAPAAAAAAGAAAMAL 64 ASSSS PL S A P A A AAP A A AGA+ +A+ Sbjct 159 ASSSSFPPPLHTSVAGAGAGAGAAPLVVAGAGAAPLAVAGAGASPLAV 206 > Hs22042372 Length=2698 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 25 SSSSSPLPASTPRPAAPAAAAPAAAAP 51 +S+S+P+PAST P + +AP A+P Sbjct 1776 ASTSAPVPASTLAPVLASTSAPVPASP 1802 Lambda K H 0.325 0.130 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181107380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40